Basic Vector Information
- Vector Name:
- pTS1
- Antibiotic Resistance:
- Tetracycline
- Length:
- 8893 bp
- Type:
- Suicide vector
- Replication origin:
- ori
- Source/Author:
- Scott TA, Heine D, Qin Z, Wilkinson B.
- Promoter:
- sacB
pTS1 vector Vector Map
pTS1 vector Sequence
LOCUS V002516 8893 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V002516 VERSION V002516 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8893) AUTHORS Scott TA, Heine D, Qin Z, Wilkinson B. TITLE An L-threonine transaldolase is required for L-threo-beta-hydroxy-alpha-amino acid assembly during obafluorin biosynthesis JOURNAL Nat Commun 8, 15935 (2017) PUBMED 28649989 REFERENCE 2 (bases 1 to 8893) AUTHORS Scott TA. TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Molecular Microbiology, John Innes Centre, Norwich Research Park, Norwich, Norfolk NR4 7UH, United Kingdom REFERENCE 3 (bases 1 to 8893) TITLE Direct Submission REFERENCE 4 (bases 1 to 8893) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun 8, 15935 (2017)" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (30-SEP-2016) Molecular Microbiology, John Innes Centre, Norwich Research Park, Norwich, Norfolk NR4 7UH, United Kingdom" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8893 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(724..1371) /label="TetR" /note="tetracycline resistance regulatory protein" CDS 1477..2673 /label="TcR" /note="tetracycline efflux protein" CDS 2679..2825 /codon_start=1 /gene="exc2" /product="Exc2" /label="exc2" /protein_id="AQZ26572.1" /translation="METIGNSLRGTTQFAGTDYRSKDLTPKKSRLLADTISAVYLDGYE GRQ" gene 2679..2825 /gene="exc2" /label="exc2" misc_feature complement(2800..3083) /label="cer region" /note="ColE1-derived recombination site that helps to maintain plasmids as monomers" CDS complement(3039..4589) /gene="mbeA" /label="DNA relaxase MbeA" /note="DNA relaxase MbeA from Escherichia coli. Accession#: P13658" CDS complement(4582..4926) /gene="mbeC" /label="Mobilization protein MbeC" /note="Mobilization protein MbeC from Escherichia coli. Accession#: P13657" CDS 4966..5154 /label="rop" /note="Rop protein, which maintains plasmids at low copy number" oriT 5242..5330 /note="oriT" rep_origin complement(5574..6164) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 6369..6710 /codon_start=1 /gene="colE1" /product="colicin E1 immunity protein" /label="colE1" /protein_id="AQZ26577.1" /translation="MSLRYYIKNILFGLYCTLIYIYLITKNSEGYYFLVSDKMLYAIVI STILCPYSKYAIEYIAFNFIKKDFFERRKNLNNAPVAKLNLFMLYNLLCLVLAIPFGLL GLFISIKNN" gene 6369..6710 /gene="colE1" /label="colE1" CDS complement(6890..8308) /label="SacB" /note="secreted levansucrase that renders bacterial growth sensitive to sucrose" promoter complement(8309..8754) /label="sacB promoter" /note="sacB promoter and control region" misc_feature 8777..8833 /label="MCS" /note="pUC18/19 multiple cloning site"
This page is informational only.