Basic Vector Information
- Vector Name:
- pTrypRNAiGate
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9177 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Kalidas S, Li Q, Phillips MA.
- Promoter:
- lac UV5
pTrypRNAiGate vector Map
pTrypRNAiGate vector Sequence
LOCUS 40924_44304 9177 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pTrypRNAiGate, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9177) AUTHORS Kalidas S, Li Q, Phillips MA. TITLE A Gateway((R)) compatible vector for gene silencing in bloodstream form Trypanosoma brucei JOURNAL Mol. Biochem. Parasitol. 178 (1-2), 51-55 (2011) PUBMED 21420443 REFERENCE 2 (bases 1 to 9177) AUTHORS Kalidas S, Li Q, Phillips M. TITLE Direct Submission JOURNAL Submitted (30-MAR-2011) Department of Pharmacology, UT Southwestern Medical Center, 6001 Forest Park Rd, Dallas, TX 75390-9041, USA REFERENCE 3 (bases 1 to 9177) TITLE Direct Submission REFERENCE 4 (bases 1 to 9177) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Mol. Biochem. Parasitol. 178 (1-2), 51-55 (2011)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (30-MAR-2011) Department of Pharmacology, UT Southwestern Medical Center, 6001 Forest Park Rd, Dallas, TX 75390-9041, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9177 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(100..732) /label=rRNA locus intergenic fragment /note="rRNA locus intergenic fragment" CDS complement(1085..1456) /codon_start=1 /label=BleoR /note="antibiotic-binding protein" /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR EFALRDPAGNCVHFVAEEQD" promoter complement(1600..1618) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 1883..1901 /label=tet operator /note="bacterial operator O2 for the tetR and tetA genes" protein_bind 1904..1922 /gene="tetO" /label=tet operator /bound_moiety="tetracycline repressor TetR" /note="bacterial operator O2 for the tetR and tetA genes" protein_bind 2053..2177 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter 2202..2232 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" CDS 2286..2942 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" CDS 3287..3589 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" protein_bind complement(3633..3757) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" protein_bind 4213..4337 /label=attR2 /note="recombination site for the Gateway(R) LR reaction" CDS complement(4381..4683) /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" CDS complement(5028..5684) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(5738..5768) /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" protein_bind complement(5793..5917) /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter complement(6413..6431) /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" promoter 7217..7321 /label=AmpR promoter CDS 7322..8179 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHSMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 8353..8941 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.