pTRKH2 vector (V002520) Gene synthesis in pTRKH2 backbone

Price Information

Cat No. Plasmid Name Availability Buy one, get one free! (?)
V002520 pTRKH2 In stock, instant shipping

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

Vector Name:
pTRKH2
Length:
6721 bp
Type:
Cloning vector
Replication origin:
p15A ori
Source/Author:
Welker DL, Hughes JE, Steele JL, Broadbent JR.

pTRKH2 vector Map

pTRKH26721 bp3006009001200150018002100240027003000330036003900420045004800510054005700600063006600CAP binding sitelac promoterlac operatorM13 revM13 fwdrRNA adenine N-6-methyltransferaseEnterococcus origin region from pAMBeta1cat promoterp15A ori

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

pTRKH2 vector Sequence

LOCUS       V002520                 6721 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V002520
VERSION     V002520
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 6721)
  AUTHORS   Welker DL, Hughes JE, Steele JL, Broadbent JR.
  TITLE     High efficiency electrotransformation of Lactobacillus casei
  JOURNAL   FEMS Microbiol. Lett. 362 (2), 1-6 (2015)
   PUBMED   25670703
REFERENCE   2  (bases 1 to 6721)
  AUTHORS   Welker DL, Hughes JE, Steele JL, Broadbent JR.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-NOV-2017) Biology, Utah State University, 5305 Old
            Main Hill, Logan, UT 84322-5305, USA
REFERENCE   3  (bases 1 to 6721)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6721)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "FEMS
            Microbiol. Lett."; date: "2015"; volume: "362"; issue: "2"; pages:
            "1-6"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (03-NOV-2017) Biology, Utah State University, 5305 Old Main Hill,
            Logan, UT 84322-5305, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6721
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    102..123
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        138..168
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    176..192
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     200..216
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     primer_bind     complement(295..311)
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     CDS             992..1726
                     /gene="ermBP"
                     /label="rRNA adenine N-6-methyltransferase"
                     /note="rRNA adenine N-6-methyltransferase from Enterococcus
                     faecalis. Accession#: P0A4D5"
     regulatory      2384..5298
                     /label="Enterococcus origin region from pAMBeta1"
                     /note="Enterococcus origin region from pAMBeta1"
                     /regulatory_class="replication_regulatory_region"
     CDS             3312..4802
                     /codon_start=1
                     /gene="repR"
                     /product="RepR"
                     /label="repR"
                     /note="DNA replication protein"
                     /protein_id="AXU41049.1"
                     /translation="MNIPFVVETVLHDGLLKYKFKNSKIRSITTKPGKSKGAIFAYRSK
                     SSMIGGRGVVLTSEEAIQENQDTFTHWTPNVYRYGTYADENRSYTKGHSENNLRQINTF
                     FIDFDIHTAKETISASDILTTAIDLGFMPTMIIKSDKGYQAYFVLETPVYVTSKSEFKS
                     VKAAKIISQNIREYFGKSLPVDLTCNHFGIARIPRTDNVEFFDPNYRYSFKEWQDWSFK
                     QTDNKGFTRSSLTVLSGTEGKKQVDEPWFNLLLHETKFSGEKGLIGRNNVMFTLSLAYF
                     SSGYSIETCEYNMFEFNNRLDQPLEEKEVIKIVRSAYSENYQGANREYITILCKAWVSS
                     DLTSKDLFVRQGWFKFKKKRSERQRVHLSEWKEDLMAYISEKSDVYKPYLVTTKKEIRE
                     VLGIPERTLDKLLKVLKANQEIFFKIKPGRNGGIQLASVKSLLLSIIKVKKEEKESYIK
                     ALTNSFDLEHTFIQETLNKLAERPKTDTQLDLFSYDTG"
     gene            3312..4802
                     /gene="repR"
                     /label="repR"
     promoter        complement(5512..5614)
                     /label="cat promoter"
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     rep_origin      complement(6140..6685)
                     /direction=LEFT
                     /label="p15A ori"
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells
                     that contain a second plasmid with the ColE1 origin."