Basic Vector Information
- Vector Name:
- pTRK1-bglT2mcsHEstop
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9207 bp
- Type:
- Reporter vector
- Replication origin:
- ori
- Source/Author:
- Vian A, Carrascosa AV, Garcia JL, Cortes E.
pTRK1-bglT2mcsHEstop vector Map
pTRK1-bglT2mcsHEstop vector Sequence
LOCUS V002525 9207 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V002525 VERSION V002525 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9207) AUTHORS Vian A, Carrascosa AV, Garcia JL, Cortes E. TITLE Structure of the beta-galactosidase gene from Thermus sp. strain T2: expression in Escherichia coli and purification in a single step of an active fusion protein JOURNAL Appl. Environ. Microbiol. 64 (6), 2187-2191 (1998) PUBMED 9603833 REFERENCE 2 (bases 1 to 9207) AUTHORS Fujita A, Misumi Y, Koyama Y. TITLE Two versatile shuttle vectors for Thermus thermophilus-Escherichia coli containing multiple cloning sites, lacZalpha gene and kanamycin or hygromycin resistance marker JOURNAL Plasmid 67 (3), 272-275 (2012) PUBMED 22252135 REFERENCE 3 (bases 1 to 9207) AUTHORS Fujita A, Misumi Y, Honda S, Sato T, Koyama Y. TITLE Construction of new cloning vectors that employ the phytoene synthase encoding gene for color screening of cloned DNA inserts in Thermus thermophilus JOURNAL Gene 527 (2), 655-662 (2013) PUBMED 23845779 REFERENCE 4 (bases 1 to 9207) AUTHORS Fujita A, Sato T, Koyama Y, Misumi Y. TITLE Development of a novel reporter gene system incorporating a gene encoding a thermostable beta-galactosidase for use in Thermus thermophilus HB27 JOURNAL Unpublished REFERENCE 5 (bases 1 to 9207) AUTHORS Fujita A. TITLE Direct Submission JOURNAL Submitted (27-JAN-2015) Contact:Atsushi Fujita National Institute of Advanced Industrial Science and Technology, Health Research Institute; 1-8-31 Midorigaoka, Ikeda, Osaka 563-8577, Japan URL :https://unit.aist.go.jp/hri/ REFERENCE 6 (bases 1 to 9207) TITLE Direct Submission REFERENCE 7 (bases 1 to 9207) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "1998"; volume: "64"; issue: "6"; pages: "2187-2191" SGRef: number: 2; type: "Journal Article"; journalName: "Plasmid"; date: "2012"; volume: "67"; issue: "3"; pages: "272-275" SGRef: number: 3; type: "Journal Article"; journalName: "Gene"; date: "2013"; volume: "527"; issue: "2"; pages: "655-662" SGRef: number: 4; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 5; type: "Journal Article"; journalName: "Submitted (27-JAN-2015) Contact:Atsushi Fujita National Institute of Advanced Industrial Science and Technology, Health Research Institute; 1-8-31 Midorigaoka, Ikeda, Osaka 563-8577, Japan URL :https://unit.aist.go.jp/hri/" SGRef: number: 6; type: "Journal Article" FEATURES Location/Qualifiers source 1..9207 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 69..123 /note="polylinker HindIII-NruI-SalI-NotI-PstI-SwaI-EcoRV-PvuII-EcoRI" CDS 137..2071 /gene="bgaA" /label="Beta-galactosidase BgaA" /note="Beta-galactosidase BgaA from Thermus sp. Accession#: O54315" CDS complement(2922..4085) /codon_start=1 /gene="repA" /product="putative repA protein" /label="repA" /protein_id="BAS05947.1" /translation="MVLRAYAALRGLSPEALRAHLLAPPLRPERAREAFQRPYLAHFAQ TLPRYPYATDDPKEGVRIYKRENALKRVHVQVGHYPHAVLRLVVDVDLPWPQVEERIHA LPPSLVLVNPRSGHFHAWYELDPIPLTPPPGREGSLKGALALLAEVEALLEAYYGADPG YNGLLSRNPFLHPPEWTWGGGKRWSLRDLHRELRGLLPSGTRRRVDPGLASYGRNNALF DRLRAEAYAHVALFRGVPGGEEAFRAWVEQRAHALNQSLFRDHPKGPLDPREVHHTAKS VAKWTYRNYRGARVYPVSSTGRPDRSRLSPQARALIPPLQGQELQEAVREGGRRRGSRR RQEAEEKLTEALKRLQARGERVTARALAREAGVKPHTASKWLKRMRE" gene complement(2922..4085) /gene="repA" /label="repA" CDS 6577..7347 /codon_start=1 /gene="KNT" /product="kanamycin nucleotidyltransferase" /label="KNT" /protein_id="BAS05948.1" /translation="MRIVNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGR QTDGPYSDIEMMCVMSTEEAEFSHEWTTGEWKAEVNFYSEEILLDYASRVEPDWPLTHG RFFSILPIYDPGGYFEKVYQTAKSVEAQKFHDAICALIVEELFEYAGKWRNIRVQGPTT FLPSLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQPDLPPGYVQLCQLVMSGQLSD PEKLLESLENFWNGIQEWTERHGYIVDVSKRIPF" gene 6577..7347 /gene="KNT" /label="KNT" CDS 7406..8263 /label="AmpR" /note="beta-lactamase" rep_origin 8437..9025 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.