Basic Vector Information
- Vector Name:
- pTrcmelA
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5989 bp
- Type:
- Bacterial expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pTrcmelA vector Map
pTrcmelA vector Sequence
LOCUS 40924_43978 5989 bp DNA circular SYN 18-DEC-2018 DEFINITION Bacterial expression vector pTrcmelA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5989) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 5989) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 5989) TITLE Direct Submission REFERENCE 4 (bases 1 to 5989) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5989 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(41..1870) /codon_start=1 /note="unnamed protein product; melA" /protein_id="SJL86559.1" /translation="MAWLVGKPSLERSWNAILSFPESGFQLECRNTIGSSVFSSHFTLH FRVARRLLHFSCRRFTETQKEPTQALWWCELPTAPAPRRRGTGLKAALILAKDNSNPRE SKMSITRRHVIVQGGVIAAGLLASGLPGTKAFAQIPSIPWRRSLQGLAWNDPIIETYRD AVRLLNALPASDKFNWVNLSKIHGSGDVVKYCPHGNWYFLPWHRAYTAMYERIVRHVTK NNDFAMPFWDWTDNPYLPEVFTMQKTPDGKDNPLYVSSRTWPITQPMPDNIVGPQVLNT ILTAKPYEVFGTTRPEGQNSLDPSWVTTSSGTQGALEYTPHNQVHNNIGGWMPEMSSPR DPIFFMHHCNIDRIWATWNLRNANSTDRLWADMPFTDNFYDVDGNFWSPKVSDLYVPEE LGYNYGFRTYFKVAAASAKTLALNDKLTSVIAATATDAAIAGVTTTSTDNSKAATENVP LSLPIKIPAGALQEIVRQPPLPSGMDTMDFGAAQEQAASAPRVLAFLRDVEITSASTTS VRVFLGKNDLKADTPVTDPHYVGSFAVLGHDGDHHRKPSFVLDLTDAIQRVYGGRGQTD GEAIDLQLIPVGSGAGKPGAVEPAKLEIAIVSA" protein_bind complement(1891..1907) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(1915..1944) /label=trc promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" CDS complement(2179..3258) /label=lacI /note="lac repressor" promoter complement(3259..3336) /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." misc_feature 3522..3662 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(3848..4436) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4610..5467) /label=AmpR /note="beta-lactamase" promoter complement(5468..5559) /label=AmpR promoter terminator complement(5579..5606) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(5698..5784) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.