Basic Vector Information
- Vector Name:
- pTrc-SeTAL
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5698 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Kim B, Binkley R, Kim HU, Lee SY.
pTrc-SeTAL vector Map
pTrc-SeTAL vector Sequence
LOCUS 40924_43913 5698 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pTrc-SeTAL, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5698) AUTHORS Kim B, Binkley R, Kim HU, Lee SY. TITLE Metabolic engineering of Escherichia coli for the enhanced production of l-tyrosine JOURNAL Biotechnol. Bioeng. (2018) In press PUBMED 30019750 REFERENCE 2 (bases 1 to 5698) AUTHORS Yang D, Kim WJ, Yoo SM, Choi JH, Ha SH, Lee MH, Lee SY. TITLE Direct Submission JOURNAL Submitted (15-JUN-2018) Dept. Chemical and Biomolecular Engineering, Korea Advanced Institute of Science and Technology, Daehak-ro 291, Daejeon 34141, South Korea REFERENCE 3 (bases 1 to 5698) TITLE Direct Submission REFERENCE 4 (bases 1 to 5698) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol. Bioeng. (2018) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-JUN-2018) Dept. Chemical and Biomolecular Engineering, Korea Advanced Institute of Science and Technology, Daehak-ro 291, Daejeon 34141, South Korea" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5698 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 193..222 /label=trc promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 230..246 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." 5'UTR 247..271 /gene="TAL" gene 247..271 /gene="TAL" /label=TAL CDS 272..1804 /codon_start=1 /gene="TAL" /product="tyrosine ammonia-lyase" /label=TAL /note="derived from Saccharothrix espanaensis" /protein_id="AXN70016.1" /translation="MTQVVERQADRLSSREYLARVVRSAGWDAGLTSCTDEEIVRMGAS ARTIEEYLKSDKPIYGLTQGFGPLVLFDADSELEQGGSLISHLGTGQGAPLAPEVSRLI LWLRIQNMRKGYSAVSPVFWQKLADLWNKGFTPAIPRHGTVSASGDLQPLAHAALAFTG VGEAWTRDADGRWSTVPAVDALAALGAEPFDWPVREALAFVNGTGASLAVAVLNHRSAL RLVRACAVLSARLATLLGANPEHYDVGHGVARGQVGQLTAAEWIRQGLPRGMVRDGSRP LQEPYSLRCAPQVLGAVLDQLDGAGDVLAREVDGCQDNPITYEGELLHGGNFHAMPVGF ASDQIGLAMHMAAYLAERQLGLLVSPVTNGDLPPMLTPRAGRGAGLAGVQISATSFVSR IRQLVFPASLTTLPTNGWNQDHVPMALNGANSVFEALELGWLTVGSLAVGVAQLAAMTG HAAEGVWAELAGICPPLDADRPLGAEVRAARDLLSAHADQLLVDEADGKDFG" gene 272..1804 /gene="TAL" /label=TAL terminator 2051..2137 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 2229..2256 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 2276..2367 /label=AmpR promoter CDS 2368..3225 /label=AmpR /note="beta-lactamase" rep_origin 3399..3987 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(4173..4313) /label=bom /note="basis of mobility region from pBR322" promoter 4499..4576 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 4577..5656 /label=lacI /note="lac repressor"
This page is informational only.