Basic Vector Information
- Vector Name:
- pTPTK2
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 5455 bp
- Type:
- E. coli-T. kodakarensis shuttle vector
- Replication origin:
- p15A ori
- Source/Author:
- Catchpole R, Gorlas A, Oberto J, Forterre P.
pTPTK2 vector Vector Map
pTPTK2 vector Sequence
LOCUS V002562 5455 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V002562 VERSION V002562 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 5455) AUTHORS Catchpole R, Gorlas A, Oberto J, Forterre P. TITLE A series of new E. coli-Thermococcus shuttle vectors compatible with previously existing vectors JOURNAL Extremophiles (2018) In press PUBMED 29497842 REFERENCE 2 (bases 1 to 5455) AUTHORS Catchpole R, Gorlas A, Oberto J, Forterre P. TITLE Direct Submission JOURNAL Submitted (05-FEB-2018) Microbiology, Institut Pasteur, 25-28 Rue du Dr Roux, Paris 75015, France REFERENCE 3 (bases 1 to 5455) TITLE Direct Submission REFERENCE 4 (bases 1 to 5455) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Extremophiles (2018) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (05-FEB-2018) Microbiology, Institut Pasteur, 25-28 Rue du Dr Roux, Paris 75015, France" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5455 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(268..813) /direction=LEFT /label="p15A ori" /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS 1253..2551 /gene="trpE" /label="Anthranilate synthase component 1" /note="Anthranilate synthase component 1 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1). Accession#: Q9YGB3" CDS complement(2582..2716) /codon_start=1 /product="transmembrane domain protein" /label="transmembrane domain protein" /protein_id="AVP12436.1" /translation="MSKKLDVKVKVNIYVNVHIDIKVAISIAVTIAVIALLKVLLNIR" CDS 2819..2968 /codon_start=1 /product="SpoVT/AbrB-like transcriptional regulator" /label="SpoVT/AbrB-like transcriptional regulator" /note="swapped-hairpin fold CDS" /protein_id="AVP12435.1" /translation="MQDVRKMFRSGSSYVVAFPPSVIQKTKFRHQRTVRVRIYDDKIVI VPLW" CDS 3631..4389 /codon_start=1 /product="RepTP2" /label="RepTP2" /protein_id="AVP12434.1" /translation="MTLMCLWFHTRTRFTSRAMLVQKLERYDSLFKVASARHTDAVFLT LTTDPSRFSNLYEANRQFSHSFNRFMSRLRGYFARRGQHLEYIAVYEFTKSGLLHAHVI IFGVRYLLPVRVISRWWSEAGQGRVVYIYRLRNVDGRWVWARRRPRDVRAGEGAEDYLK KYLRKALRLASTLDTSDVKKVLPLALYWAFNKRFFTYSRSLLPSSRRTAEAVVSEYLWV GTYRLEDLPDWVFWLPHRVYSPPSRGPPPT" CDS complement(4438..5094) /label="CmR" /note="chloramphenicol acetyltransferase" promoter complement(5095..5197) /label="cat promoter" /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase"
This page is informational only.