Basic Vector Information
- Vector Name:
- pTpPuc3
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7796 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Karas BJ, Diner RE, Lefebvre SC, Weyman PD.
- Promoter:
- HIS3
pTpPuc3 vector Map
pTpPuc3 vector Sequence
LOCUS 40924_43823 7796 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pTpPuc3, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7796) AUTHORS Karas BJ, Diner RE, Lefebvre SC, Weyman PD. TITLE Designer Diatom episomes Delivered by Bacterial Conjugation JOURNAL Unpublished REFERENCE 2 (bases 1 to 7796) AUTHORS Karas BJ, Diner RE, Lefebvre SC, Weyman PD. TITLE Direct Submission JOURNAL Submitted (03-FEB-2015) Synthetic Biology and Bioenergy Group, J. Craig Venter Institute, 4120 Capricorn Lane, La Jolla, CA 92037, USA REFERENCE 3 (bases 1 to 7796) TITLE Direct Submission REFERENCE 4 (bases 1 to 7796) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (03-FEB-2015) Synthetic Biology and Bioenergy Group, J. Craig Venter Institute, 4120 Capricorn Lane, La Jolla, CA 92037, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..7796 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(310..678) /codon_start=1 /label=traJ /note="oriT-recognizing protein" /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE KQDELGKVMMGVVRPRAEP" oriT complement(711..820) /direction=LEFT /label=oriT /note="incP origin of transfer" primer_bind 1098..1114 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS 2096..2662 /codon_start=1 /label=NrsR /note="nourseothricin acetyltransferase" /translation="MTTLDDTAYRYRTSVPGDAEAIEALDGSFTTDTVFRVTATGDGFT LREVPVDPPLTKVFPDDESDDESDAGEDGDPDSRTFVAYGDDGDLAGFVVVSYSGWNRR LTVEDIEVAPEHRGHGVGRALMGLATEFARERGAGHLWLEVTNVNAPAIHAYRRMGFTL CGLDTALYDGTASDGEQALYMSMPCP" misc_feature 3185..3688 /label=CEN/ARS /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" promoter 3689..3876 /label=HIS3 promoter CDS 3877..4533 /codon_start=1 /label=HIS3 /note="imidazoleglycerol-phosphate dehydratase, required for histidine biosynthesis" /translation="MTEQKALVKRITNETKIQIAISLKGGPLAIEHSIFPEKEAEAVAE QATQSQVINVHTGIGFLDHMIHALAKHSGWSLIVECIGDLHIDDHHTTEDCGIALGQAF KEALLARGVKRFGSGFAPLDEALSRAVVDLSNRPYAVVELGLQREKVGDLSCEMIPHFL ESFAEASRITLHVDCLRGKNDHHRSESAFKALAVAIREATSPNGTNDVPSTKGVLM" primer_bind complement(4605..4621) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4629..4645) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4653..4683) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4698..4719) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(5007..5595) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 6443..7255 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" promoter complement(7597..7701) /label=AmpR promoter
This page is informational only.