Basic Vector Information
- Vector Name:
- pTNTrpE
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9026 bp
- Type:
- E. coli-T. kodakarensis shuttle vector
- Replication origin:
- ori
- Source/Author:
- Catchpole R, Gorlas A, Oberto J, Forterre P.
pTNTrpE vector Vector Map
pTNTrpE vector Sequence
LOCUS V002573 9026 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V002573 VERSION V002573 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9026) AUTHORS Catchpole R, Gorlas A, Oberto J, Forterre P. TITLE A series of new E. coli-Thermococcus shuttle vectors compatible with previously existing vectors JOURNAL Extremophiles (2018) In press PUBMED 29497842 REFERENCE 2 (bases 1 to 9026) AUTHORS Catchpole R, Gorlas A, Oberto J, Forterre P. TITLE Direct Submission JOURNAL Submitted (05-FEB-2018) Microbiology, Institut Pasteur, 25-28 Rue du Dr Roux, Paris 75015, France REFERENCE 3 (bases 1 to 9026) TITLE Direct Submission REFERENCE 4 (bases 1 to 9026) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Extremophiles (2018) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (05-FEB-2018) Microbiology, Institut Pasteur, 25-28 Rue du Dr Roux, Paris 75015, France" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9026 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 17..605 /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 893..914 /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." promoter 929..959 /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind 967..983 /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 991..1007 /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" CDS 1586..2236 /codon_start=1 /product="p24" /label="p24" /protein_id="AVP12426.1" /translation="MESGENTPYKKFICLHCGHVFDSDRDAPKCPNCGRRKVIPRETLG ESLRKHKDKLKELGVLPEPDPEPQETEVGKAEVETAGQKDPETSKPEPIQVEQKVEELK PESDQEPQNSESVDSPDDVPESDKLLAKYLEELEDVPAKPKPKKLRPKKSKRSITVPAG PSFLEVLIIIGAIVLIWKWLSSRSSKSDDESNVPRPSETYYQIQRNLGHHVLG" CDS 2771..4696 /codon_start=1 /product="Rep74" /label="Rep74" /protein_id="AVP12425.1" /translation="MRLSNSSINSLLSSGSCDVVGSSPSGSPFLPQSTGSTQKTLSVYL DISPTNEKGEPSVRGPTIRVSSHPLPAYAYYRSATGHLERQKFESQGRVKIDIYKLRKK LFWIRRRLERVDLTDEERSSLEAERDRLVSLTEKLLRKIYSGSALYGDRFVIDVPVAYS QLCKALGINPSDVGVSLFVRSAVMDLEFDDSSRSALKISYVSRLFAGKYHPAKGISKGF KEARRVVRDLLVLQEFLDGSLLSYHKGDYVTSNSLLPMRFFVLTLPEEISYYIWSKLRE GDDSALKLFKKISSQAIRDFLFYLAQKEGIPINKSYFVPGFLQNIHPTGDRDPFKPHFH AHFSVVFVVYDKSSHTWYRLNPVLDEADLEKLREIWKALVVEAFSEILSGDTLTKDFNV WVGDRYYSLPHDYVGVLFEIKYNARKMFVNYSSYYERNSFSDDFDRSFVSFIFDYKNRT ERYGFLTNIKRYLSRLSISAVKKRLEELRELLDRIEADLLVVDSGRFPLLYQSLLDKRE AVQSEISRLESVLNNPDDAFRVLYDEISRDVESMLSPRTVKENRIVSLLESLHGKRVVG LSVEYIRYLTRDGEEVLDVPLHKFLEARRSVVLLSDRHKTVEFMLWWDPFWEDPPDVLE LKIPNS" CDS 4859..6157 /gene="trpE" /label="Anthranilate synthase component 1" /note="Anthranilate synthase component 1 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1). Accession#: Q9YGB3" promoter complement(6246..6264) /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(6271..6287) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" rep_origin 6428..6856 /label="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS 7200..7991 /label="NeoR/KanR" /note="aminoglycoside phosphotransferase" CDS 8012..8869 /label="AmpR" /note="beta-lactamase"
This page is informational only.