Basic Vector Information
- Vector Name:
- pTNS2-ColE1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10445 bp
- Type:
- Tn7 transposase expression vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Lee KW, Periasamy S, Mukherjee M, Xie C, Kjelleberg S, Rice SA.
pTNS2-ColE1 vector Map
pTNS2-ColE1 vector Sequence
LOCUS V002577 10445 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V002577 VERSION V002577 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 10445) AUTHORS Lee KW, Periasamy S, Mukherjee M, Xie C, Kjelleberg S, Rice SA. TITLE Biofilm development and enhanced stress resistance of a model, mixed-species community biofilm JOURNAL ISME J 8 (4), 894-907 (2014) PUBMED 24152718 REFERENCE 2 (bases 1 to 10445) AUTHORS Lee KWK., Periasamy S, Mukherjee M, Xie C, Kjelleberg S, Rice SA. TITLE Direct Submission JOURNAL Submitted (15-SEP-2014) Singapore Centre on Environmental Life Sciences Engineering, Nanyang Technological University, 60 Nanyang Drive, SBS-01N-27 637551, Singapore REFERENCE 3 (bases 1 to 10445) TITLE Direct Submission REFERENCE 4 (bases 1 to 10445) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "ISME J"; date: "2014"; volume: "8"; issue: "4"; pages: "894-907" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-SEP-2014) Singapore Centre on Environmental Life Sciences Engineering, Nanyang Technological University, 60 Nanyang Drive, SBS-01N-27 637551, Singapore" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10445 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" CDS complement(690..2216) /codon_start=1 /gene="tnsD" /product="TnsD" /label="tnsD" /note="Tn7 transposition site selector" /protein_id="AIZ73053.1" /translation="MRNFPVPYSNELIYSTIARAGVYQGIVSPKQLLDEVYGNRKVVAT LGLPSHLGVIARHLHQTGRYAVQQLIYEHTLFPLYAPFVGKERRDEAIRLMEYQAQGAV HLMLGVAASRVKSDNRFRYCPDCVALQLNRYGEAFWQRDWYLPALPYCPKHGALVFFDR AVDDHRHQFWALGHTELLSDYPKDSLSQLTALAAYIAPLLDAPRAQELSPSLEQWTLFY QRLAQDLGLTKSKHIRHDLVAERVRQTFSDEALEKLDLKLAENKDTCWLKSIFRKHRKA FSYLQHSIVWQALLPKLTVIEALQQASALTEHSITTRPVSQSVQPNSEDLSVKHKDWQQ LVHKYQGIKAARQSLEGGVLYAWLYRHDRDWLVHWNQQHQQERLAPAPRVDWNQRDRIA VRQLLRIIKRLDSSLDHPRATSSWLLKQTPNGTSLAKNLQKLPLVALCLKRYSESVEDY QIRRISQAFIKLKQEDVELRRWRLLRSATLSKERITEEAQRFLEMVYGEE" gene complement(690..2216) /gene="tnsD" /label="tnsD" CDS complement(2222..3886) /gene="tnsC" /label="Transposon Tn7 transposition protein TnsC" /note="Transposon Tn7 transposition protein TnsC from Escherichia coli. Accession#: P05846" CDS complement(3886..5991) /gene="tnsB" /label="Transposon Tn7 transposition protein TnsB" /note="Transposon Tn7 transposition protein TnsB from Escherichia coli. Accession#: P13989" mobile_element 6709..6933 /label="Tn7R" /note="mini-Tn7 element (right end of the Tn7 transposon)" rep_origin complement(7197..7785) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" primer_bind complement(7971..7987) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind 7995..8011 /label="lac operator" /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(8019..8049) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(8064..8085) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." oriT 8461..8569 /label="oriT" /note="incP origin of transfer" rep_origin 8592..8976 /label="R6K gamma ori" /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" CDS complement(9388..10245) /label="AmpR" /note="beta-lactamase" promoter complement(10246..10350) /label="AmpR promoter"
This page is informational only.