pC034 - LwCas13a-msfGFP-2A-Blast vector (V010684)

Price Information

Cat No. Plasmid Name Availability Add to cart
V010684 pC034 - LwCas13a-msfGFP-2A-Blast In stock, 1 week for quality controls

Buy one, get one free!

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

Vector Name:
pC034 - LwCas13a-msfGFP-2A-Blast
Antibiotic Resistance:
Ampicillin
Length:
13090 bp
Type:
Mammalian Expression, Lentiviral
Replication origin:
ori
Selection Marker:
Blasticidin
Copy Number:
High Copy
Promoter:
EFS
Cloning Method:
Gibson Cloning
5' Primer:
ctaggtcttgaaaggagtggg

pC034 - LwCas13a-msfGFP-2A-Blast vector Map

pC034 - LwCas13a-msfGFP-2A-Blast13090 bp6001200180024003000360042004800540060006600720078008400900096001020010800114001200012600CMV enhancerCMV promoter5' LTR (truncated)HIV-1 PsiRREgp41 peptideProtein TatcPPT/CTSEF-1-alpha core promoternucleoplasmin NLSLwCas13asuperfolder GFPnucleoplasmin NLSHAHAHAP2ABSDWPREpBluescriptKS5' LTR (truncated)bGH poly(A) signalf1 oriSV40 promoterEM7 promoterBleoRSV40 poly(A) signalIn lacZ genelac promoterCAP binding siteL4440oriAmpRAmpR promoterpRS-marker

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

pC034 - LwCas13a-msfGFP-2A-Blast vector Sequence

LOCUS       V010684                13090 bp    DNA     circular SYN 13-MAY-2021
DEFINITION  Exported.
ACCESSION   V010684
VERSION     V010684
KEYWORDS    pC034 - LwCas13a-msfGFP-2A-Blast
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 13090)
  AUTHORS   Abudayyeh OO, Gootenberg JS, Essletzbichler P, Han S, Joung J,
            Belanto JJ, Verdine V, Cox DBT, Kellner MJ, Regev A, Lander ES,
            Voytas DF, Ting AY, Zhang F
  TITLE     RNA targeting with CRISPR-Cas13.
  JOURNAL   Nature. 2017 Oct 4. doi: 10.1038/nature24049.
   PUBMED   28976959
REFERENCE   2  (bases 1 to 13090)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 13090)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nature.
            2017 Oct 4. doi: 10.1038/nature24049."
            SGRef: number: 2; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..13090
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        1..380
                     /label="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        381..583
                     /label="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     LTR             598..778
                     /label="5' LTR (truncated)"
                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"
     misc_feature    825..950
                     /label="HIV-1 Psi"
                     /note="packaging signal of human immunodeficiency virus
                     type 1"
     misc_feature    1443..1676
                     /label="RRE"
                     /note="The Rev response element (RRE) of HIV-1 allows for
                     Rev-dependent mRNA export from the nucleus to the
                     cytoplasm."
     CDS             1861..1905
                     /label="gp41 peptide"
                     /note="antigenic peptide corresponding to amino acids 655
                     to 669 of the HIV envelope protein gp41 (Lutje Hulsik et
                     al., 2013)"
     CDS             2054..2095
                     /note="Protein Tat from Human immunodeficiency virus type 1
                     group M subtype B (isolate WMJ22). Accession#: P12509"
                     /label="Protein Tat"
     misc_feature    2203..2320
                     /label="cPPT/CTS"
                     /note="central polypurine tract and central termination
                     sequence of HIV-1"
     promoter        2413..2624
                     /label="EF-1-alpha core promoter"
                     /note="core promoter for human elongation factor
                     EF-1-alpha"
     CDS             2652..2699
                     /codon_start=1
                     /product="bipartite nuclear localization signal from
                     nucleoplasmin"
                     /label="nucleoplasmin NLS"
                     /translation="KRPAATKKAGQAKKKK"
     CDS             2706..6161
                     /label="LwCas13a"
                     /note="Leptotrichia wadei CRISPR-Cas effector that acts as
                     an RNA-guided RNAse (Abudayyeh et al., 2017)"
     CDS             6207..6920
                     /label="superfolder GFP"
                     /note="GFP variant that folds robustly even when fused to
                     poorly folded proteins (Pedelacq et al., 2006)"
     CDS             6927..6974
                     /codon_start=1
                     /product="bipartite nuclear localization signal from
                     nucleoplasmin"
                     /label="nucleoplasmin NLS"
                     /translation="KRPAATKKAGQAKKKK"
     CDS             6975..7001
                     /label="HA"
                     /note="HA (human influenza hemagglutinin) epitope tag"
     CDS             7002..7028
                     /label="HA"
                     /note="HA (human influenza hemagglutinin) epitope tag"
     CDS             7029..7055
                     /label="HA"
                     /note="HA (human influenza hemagglutinin) epitope tag"
     CDS             7065..7121
                     /codon_start=1
                     /product="2A peptide from porcine teschovirus-1
                     polyprotein"
                     /label="P2A"
                     /note="Eukaryotic ribosomes fail to insert a peptide bond
                     between the Gly and Pro residues, yielding separate
                     polypeptides."
                     /translation="ATNFSLLKQAGDVEENPGP"
     CDS             7122..7520
                     /codon_start=1
                     /gene="Aspergillus terreus BSD"
                     /product="blasticidin S deaminase"
                     /label="BSD"
                     /note="confers resistance to blasticidin"
                     /translation="MAKPLSQEESTLIERATATINSIPISEDYSVASAALSSDGRIFTG
                     VNVYHFTGGPCAELVVLGTAAAAAAGNLTCIVAIGNENRGILSPCGRCRQVLLDLHPGI
                     KAIVKDSDGQPTAVGIRELLPSGYVWEG"
     misc_feature    7545..8133
                     /label="WPRE"
                     /note="woodchuck hepatitis virus posttranscriptional
                     regulatory element"
     primer_bind     complement(8136..8152)
                     /label="KS primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     primer_bind     complement(8137..8153)
                     /label="pBluescriptKS"
                     /note="For pBluescript vector"
     LTR             8658..8838
                     /label="5' LTR (truncated)"
                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"
     polyA_signal    8870..9094
                     /label="bGH poly(A) signal"
                     /note="bovine growth hormone polyadenylation signal"
     rep_origin      9140..9568
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        9582..9911
                     /label="SV40 promoter"
                     /note="SV40 enhancer and early promoter"
     promoter        9959..10006
                     /label="EM7 promoter"
                     /note="synthetic bacterial promoter "
     CDS             10025..10396
                     /label="BleoR"
                     /note="antibiotic-binding protein"
     polyA_signal    10529..10662
                     /label="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     primer_bind     complement(10699..10715)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     primer_bind     complement(10699..10715)
                     /label="M13 Reverse"
                     /note="In lacZ gene. Also called M13-rev"
     primer_bind     complement(10712..10734)
                     /label="M13/pUC Reverse"
                     /note="In lacZ gene"
     protein_bind    10723..10739
                     /label="lac operator"
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(10747..10777)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(10792..10813)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     primer_bind     complement(10930..10947)
                     /label="L4440"
                     /note="L4440 vector, forward primer"
     rep_origin      complement(11101..11689)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(11863..12720)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(12721..12825)
                     /label="AmpR promoter"
     primer_bind     complement(12900..12919)
                     /label="pRS-marker"
                     /note="pRS vectors, use to sequence yeast selectable
                     marker"