Mega PiggyBac Transposase vector (V018124)

Basic Vector Information

Mega-PiggyBac is a hyperactive synthetic variant of the PiggyBac transposase, engineered through fine-tuning the ProGen2 protein language model (pLLM) using over 13,000 bioprospected PiggyBac sequences. Derived from targeted optimization of the laboratory-evolved hyperactive PiggyBac (HyPB), it stands out for its superior transposition efficiency—exhibiting both significantly higher excision activity and nontargeted integration activity compared to HyPB in HEK293T cells. Notably, Mega-PiggyBac (designated as seq3277) demonstrates excellent compatibility with advanced genome-editing systems, such as the FiCAT targeted integration platform, enabling a twofold improvement in site-specific insertion at loci like AAVS1-3, TTR, and PCSK9. Its robust performance extends to critical therapeutic contexts, including functional activity in primary T cells, making it a promising tool for gene therapy and synthetic biology applications that require efficient and precise large DNA fragment integration. This plasmid shares the same backbone as the Super PiggyBac Transposase vector (V012800).

Vector Name:
Mega PiggyBac Transposase
Antibiotic Resistance:
Ampicillin
Length:
8543 bp
Type:
PiggyBac
Copy Number:
High copy number
Promoter:
rPolr2A
Growth Strain(s):
DH10B
Growth Temperature:
37℃

Mega PiggyBac Transposase vector Map

Mega PiggyBac Transposase8543 bp4008001200160020002400280032003600400044004800520056006000640068007200760080008400chicken 5'-HS4 beta-globin insulator (HS4)SK primerPolr2A promoterSV40 intronMega-PiggyBacSV40 poly(A) signalT3 promoterM13 revlac operatorlac promoterCAP binding siteoriAmpRAmpR promoterf1 oriM13 fwdT7 promoter

References

  • Ivančić D, Agudelo A, Lindstrom-Vautrin J, Jaraba-Wallace J, Gallo M, Das R, Ragel A, Herrero-Vicente J, Higueras I, Billeci F, Sanvicente-García M, Petazzi P, Ferruz N, Sánchez-Mejías A, Güell M. Discovery and protein language model-guided design of hyperactive transposases. Nat Biotechnol. 2025 Oct 2. doi: 10.1038/s41587-025-02816-4. Epub ahead of print. PMID: 41039042.

Mega PiggyBac Transposase vector Sequence

LOCUS       Exported                8543 bp DNA     circular SYN 14-NOV-2025
DEFINITION  synthetic circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    Mega PiggyBac Transposase
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8543)
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 8543)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 8543)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8543)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
COMMENT     SGRef: number: 2; type: "Journal Article"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8543
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     source          3411..3422
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    18..1993
                     /label=chicken 5'-HS4 beta-globin insulator (HS4)
                     /note="Insulators are DNA sequence elements that prevent 
                     inappropriate interactions between adjacent chromatin 
                     domains. One type of insulator establishes domains that 
                     separate enhancers and promoters to block their 
                     interaction, whereas a second type creates a barrier 
                     against the spread of heterochromatin."
     primer_bind     2449..2465
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        2492..3197
                     /label=Polr2A promoter
                     /note="RNA polymerase II large subunit promoter"
     intron          3454..3550
                     /label=SV40 intron
                     /note="modified SV40 intron with splice donor and acceptor 
                     sites"
     CDS             3626..5407
                     /codon_start=1
                     /product="Mega-PiggyBac"
                     /label=Mega-PiggyBac
                     /note="Mega-PiggyBac"
                     /translation="MGSSLDDEHILSALLQSDDELVGEDSDSEVSDHVSEDDVQSDTEE
                     AFIDEVHEVQPTSSGSEILDEQNVIEQPGSSLASNRILTLPQRTIRGKNKHCWSTSKPT
                     RRSRVSALNIVRSQRGPTRMCRNIYDPLLCFKLFFTDEIISEIVKWTNAEISLKRRESM
                     TSATFRDTNEDEIRAFFGILVMTAVRKDNHMSTDDLFDRSLSMVYVSVMSRDRFDFLIR
                     CLRMDDKSIRPTLRESDVFTPVRKIWDIFINQCIQNYTPGAHLTIDEQLLGFRGRCPFR
                     VYIPNKPSKYGIKIVMICDSGTKYMINGMPYLGRGTQTNGVPLGEYYVKELSKPVRGSC
                     RNITCDNWFTSIPLAKNLLQEPYKLTLVGTVRSNKREIPEELKNSRSRPVGTSMFCFDG
                     PLTLVSYKPKPAKMVYLLSSCDEDAIINETTGKPEMIMYYNQTKGGVDTLDQMCSLMSC
                     SRKTNRWPMALFYGMINIACINSYIIYCHNVSSKGEKVQSRKKFMKNLYKGLTSSFMRK
                     RLEAPTLKRYLRDNISNILPKEVPGTSDDSTEEPVMKKRTYCTYCPSKIRRKASASCKK
                     CKKVICREHNIDMCQSCF"
     polyA_signal    complement(5436..5570)
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     promoter        complement(5687..5705)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(5726..5742)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(5750..5766)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(5774..5804)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(5819..5840)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(6128..6716)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(6890..7747)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(7748..7852)
                     /label=AmpR promoter
     rep_origin      7879..8334
                     /direction=RIGHT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     8475..8491
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        8501..8519
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"

This page is informational only.