pJCX4 vector (Cat. No.: V018108)
Note: Express in mammalian cells a target protein C-terminally fused to the Mxe GryA intein - chitin binding domain (CBD) tag.
- Name:
- pJCX4
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5409 bp
- Type:
- Mammalian Expression Vectors
- Source/Author:
- Roberto Dominguez
- Copy Number:
- High copy number
- Promoter:
- CMV
- Growth Strain(s):
- Top10
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pJCX4 vector (Cat. No.: V018108) Sequence
LOCUS Exported 5409 bp DNA circular SYN 10-JUL-2025
DEFINITION synthetic circular DNA
ACCESSION .
VERSION .
KEYWORDS pJCX4
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5409)
AUTHORS .
TITLE Direct Submission
FEATURES Location/Qualifiers
source 1..5409
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin 109..697
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
enhancer 872..1175
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 1176..1379
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
CDS 1450..2043
/codon_start=1
/gene="Mycobacterium xenopi gyrA"
/product="modified GyrA intein (Southworth et al., 1999)"
/label=Mxe GyrA intein
/note="N-terminal cleavage of this intein can be induced by
thiols."
/translation="CITGDALVALPEGESVRIADIVPGARPNSDNAIDLKVLDRHGNPV
LADRLFHSGEHPVYTVRTVEGLRVTGTANHPLLCLVDVAGVPTLLWKLIDEIKPGDYAV
IQRSAFSVDCAGFARGKPEFAPTTYTVGVPGLVRFLEAHHRDPDAQAIADELTDGRFYY
AKVASVTDAGVQPVYSLRVDTADHAFITNGFVSHA"
CDS 2074..2229
/codon_start=1
/gene="Bacillus circulans chiA"
/product="chitin binding domain from chitinase A1 (Watanabe
et al., 1994)"
/label=CBD
/translation="TTNPGVSAWQVNTAYTAGQLVTYNGKTYKCLQPHTSLAGWEPSNV
PALWQLQ"
terminator 2308..2355
/label=T7 terminator
/note="transcription terminator for bacteriophage T7 RNA
polymerase"
misc_feature 2403..2991
/label=WPRE
/note="woodchuck hepatitis virus posttranscriptional
regulatory element"
CDS complement(2874..2885)
/codon_start=1
/product="Factor Xa recognition and cleavage site"
/label=Factor Xa site
/translation="IEGR"
polyA_signal 3008..3129
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
rep_origin complement(3136..3591)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 3618..3722
/gene="bla"
/label=AmpR promoter
promoter 3724..4081
/label=SV40 promoter
/note="SV40 enhancer and early promoter"
rep_origin 3932..4067
/label=SV40 ori
/note="SV40 origin of replication"
CDS 4116..4910
/codon_start=1
/gene="aph(3')-II (or nptII)"
/product="aminoglycoside phosphotransferase from Tn5"
/label=NeoR/KanR
/note="confers resistance to neomycin, kanamycin, and G418
(Geneticin(R))"
/translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
polyA_signal 5142..5189
/label=HSV TK poly(A) signal
/note="herpes simplex virus thymidine kinase
polyadenylation signal (Cole and Stacy, 1985)"