Basic Vector Information
- Vector Name:
- pYM35
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4866 bp
- Type:
- Yeast Plasmids
- Source/Author:
- Janke C et al.
- Promoter:
- TEF
pYM35 vector Map
pYM35 vector Sequence
LOCUS Exported 4866 bp DNA circular SYN 22-NOV-2024 DEFINITION synthetic circular DNA ACCESSION P30247 VERSION . KEYWORDS pYM35 SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4866) AUTHORS Self JOURNAL Unpublished. REFERENCE 2 (bases 1 to 4866) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished." COMMENT A versatile toolbox for PCR-based tagging of yeast genes: new fluorescent proteins, more markers and promoter substitution cassettes. Janke C, Magiera MM, Rathfelder N, Taxis C, Reber S, Maekawa H, Moreno-Borchart A, Doenges G, Schwob E, Schiebel E, Knop M. Yeast (2004) 21, 947 - 962 FEATURES Location/Qualifiers source 1..4866 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 79..759 /codon_start=1 /product="wild-type DsRed" /label=DsRed1 /note="mammalian codon-optimized" /translation="MVRSSKNVIKEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGHNTV KLKVTKGGPLPFAWDILSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGG VVTVTQDSSLQDGCFIYKVKFIGVNFPSDGPVMQKKTMGWEASTERLYPRDGVLKGEIH KALKLKDGGHYLVEFKSIYMAKKPVQLPGYYYVDSKLDITSHNEDYTIVEQYERTEGRH HLFL" terminator 781..968 /gene="S. cerevisiae ADH1" /label=ADH1 terminator /note="transcription terminator for the S. cerevisiae alcohol dehydrogenase 1 (ADH1) gene" gene 1043..2399 /label=kanMX /note="yeast selectable marker conferring kanamycin resistance (Wach et al., 1994)" promoter 1043..1386 /label=TEF promoter /note="Ashbya gossypii TEF promoter" CDS 1387..2196 /gene="kanMX" /label=kanMX terminator 2202..2399 /label=TEF terminator /note="Ashbya gossypii TEF terminator" promoter complement(2504..2522) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" rep_origin complement(2780..3368) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3539..4399) /gene="AmpR" /label=AmpR promoter complement(4400..4504) /gene="bla" /label=AmpR promoter promoter join(4850..4866,1..2) /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.