Price Information
| Cat No. | Plasmid Name | Availability | Add to cart |
|---|---|---|---|
| V017506 | pYM35 | In stock, instant shipping |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pYM35
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4866 bp
- Type:
- Yeast Plasmids
- Source/Author:
- Janke C et al.
- Promoter:
- TEF
- Growth Strain(s):
- DH10B
- Growth Temperature:
- 37℃
pYM35 vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pYM35 vector Sequence
LOCUS Exported 4866 bp DNA circular SYN 22-NOV-2024
DEFINITION synthetic circular DNA
ACCESSION P30247
VERSION .
KEYWORDS pYM35
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4866)
AUTHORS Self
JOURNAL Unpublished.
REFERENCE 2 (bases 1 to 4866)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished."
COMMENT A versatile toolbox for PCR-based tagging of yeast genes: new
fluorescent proteins, more markers and promoter substitution
cassettes. Janke C, Magiera MM, Rathfelder N, Taxis C, Reber S,
Maekawa H, Moreno-Borchart A, Doenges G, Schwob E, Schiebel E,
Knop M. Yeast (2004) 21, 947 - 962
FEATURES Location/Qualifiers
source 1..4866
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 79..759
/codon_start=1
/product="wild-type DsRed"
/label=DsRed1
/note="mammalian codon-optimized"
/translation="MVRSSKNVIKEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGHNTV
KLKVTKGGPLPFAWDILSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGG
VVTVTQDSSLQDGCFIYKVKFIGVNFPSDGPVMQKKTMGWEASTERLYPRDGVLKGEIH
KALKLKDGGHYLVEFKSIYMAKKPVQLPGYYYVDSKLDITSHNEDYTIVEQYERTEGRH
HLFL"
terminator 781..968
/gene="S. cerevisiae ADH1"
/label=ADH1 terminator
/note="transcription terminator for the S. cerevisiae
alcohol dehydrogenase 1 (ADH1) gene"
gene 1043..2399
/label=kanMX
/note="yeast selectable marker conferring kanamycin
resistance (Wach et al., 1994)"
promoter 1043..1386
/label=TEF promoter
/note="Ashbya gossypii TEF promoter"
CDS 1387..2196
/gene="kanMX"
/label=kanMX
terminator 2202..2399
/label=TEF terminator
/note="Ashbya gossypii TEF terminator"
promoter complement(2504..2522)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
rep_origin complement(2780..3368)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(3539..4399)
/gene="AmpR"
/label=AmpR
promoter complement(4400..4504)
/gene="bla"
/label=AmpR promoter
promoter join(4850..4866,1..2)
/label=SP6 promoter
/note="promoter for bacteriophage SP6 RNA polymerase"