Basic Vector Information
- Vector Name:
- pPpT4_MFalpha_eGFP
- Antibiotic Resistance:
- Bleomycin
- Length:
- 4477 bp
- Type:
- Yeast Expression
- Replication origin:
- ori
- Host:
- Yeast
- Copy Number:
- High copy number
- Promoter:
- AOX1
- Growth Strain(s):
- DH5alpha
- Growth Temperature:
- 37℃
pPpT4_MFalpha_eGFP vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pPpT4_MFalpha_eGFP vector Sequence
LOCUS Exported 4477 bp DNA circular SYN 29-MAY-2024 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4477) TITLE Direct Submission REFERENCE 2 (bases 1 to 4477) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT Imported using the Genbank importer. File name: pPpT4_Alph_formatiert.gb FEATURES Location/Qualifiers source 1..4477 /mol_type="other DNA" /organism="synthetic DNA construct" source 140..1070 /mol_type="other DNA" /db_xref="taxon:1182041" /organism="Escherichia coli-Pichia pastoris shuttle vector pPpT4" source 2972..3346 /mol_type="other DNA" /db_xref="taxon:1182041" /organism="Escherichia coli-Pichia pastoris shuttle vector pPpT4" source 3348..3823 /mol_type="other DNA" /db_xref="taxon:1182041" /organism="Escherichia coli-Pichia pastoris shuttle vector pPpT4" misc_feature 6..131 /label=P_AOX1_Syn_dBamHI regulatory 140..1070 /label=AOX1 promoter /note="AOX1 promoter" /regulatory_class="promoter" primer_bind complement(1071..1083) /label=rv(pPpT4) CDS 1084..1350 /codon_start=1 /label=Signal sequence (MF-alpha) /translation="MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLE GDFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEA" CDS 1351..2067 /codon_start=1 /label=Gene of Interest GOI (eGFP) /translation="ASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKA NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE FVTAAGITHGMDELYK" primer_bind 2068..2087 /label=fw(pPpT4) terminator 2088..2334 /gene="Pichia pastoris AOX1" /label=AOX1 terminator /note="transcription terminator for AOX1" promoter 2349..2906 /label=P_ILV5 promoter 2907..2970 /label=P_EM72_Syn CDS 2972..3346 /codon_start=1 /product="zeocin resistance protein" /label=zeocin resistance protein /protein_id="AFJ20653.1" /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR EFALRDPAGNCVHFVAEEQD" regulatory 3348..3823 /label=AOD terminator /note="AOD terminator" /regulatory_class="terminator" rep_origin 3870..4458 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.