Basic Vector Information
- Vector Name:
- pPpT4_MFalpha_eGFP
- Antibiotic Resistance:
- Bleomycin
- Length:
- 4477 bp
- Type:
- Yeast Expression
- Replication origin:
- ori
- Host:
- Yeast
- Copy Number:
- High copy number
- Promoter:
- AOX1
- Growth Strain(s):
- DH5alpha
- Growth Temperature:
- 37℃
pPpT4_MFalpha_eGFP vector Map
pPpT4_MFalpha_eGFP vector Sequence
LOCUS Exported 4477 bp DNA circular SYN 29-MAY-2024 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4477) TITLE Direct Submission REFERENCE 2 (bases 1 to 4477) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT Imported using the Genbank importer. File name: pPpT4_Alph_formatiert.gb FEATURES Location/Qualifiers source 1..4477 /mol_type="other DNA" /organism="synthetic DNA construct" source 140..1070 /mol_type="other DNA" /db_xref="taxon:1182041" /organism="Escherichia coli-Pichia pastoris shuttle vector pPpT4" source 2972..3346 /mol_type="other DNA" /db_xref="taxon:1182041" /organism="Escherichia coli-Pichia pastoris shuttle vector pPpT4" source 3348..3823 /mol_type="other DNA" /db_xref="taxon:1182041" /organism="Escherichia coli-Pichia pastoris shuttle vector pPpT4" misc_feature 6..131 /label=P_AOX1_Syn_dBamHI regulatory 140..1070 /label=AOX1 promoter /note="AOX1 promoter" /regulatory_class="promoter" primer_bind complement(1071..1083) /label=rv(pPpT4) CDS 1084..1350 /codon_start=1 /label=Signal sequence (MF-alpha) /translation="MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLE GDFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEA" CDS 1351..2067 /codon_start=1 /label=Gene of Interest GOI (eGFP) /translation="ASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKA NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE FVTAAGITHGMDELYK" primer_bind 2068..2087 /label=fw(pPpT4) terminator 2088..2334 /gene="Pichia pastoris AOX1" /label=AOX1 terminator /note="transcription terminator for AOX1" promoter 2349..2906 /label=P_ILV5 promoter 2907..2970 /label=P_EM72_Syn CDS 2972..3346 /codon_start=1 /product="zeocin resistance protein" /label=zeocin resistance protein /protein_id="AFJ20653.1" /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR EFALRDPAGNCVHFVAEEQD" regulatory 3348..3823 /label=AOD terminator /note="AOD terminator" /regulatory_class="terminator" rep_origin 3870..4458 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.