pBLO 64.1 vector (V017487)

Basic Vector Information

      • Vector Name:
      • pBLO 64.1
      • Antibiotic Resistance:
      • Chloramphenicol
      • Length:
      • 5559 bp
      • Type:
      • Gene knockout
      • Replication origin:
      • p15A ori
      • Host:
      • E. coli
      • Promoter:
      • Tet
      • Growth Strain(s):
      • DH5a
      • Growth Temperature:
      • 37℃

pBLO 64.1 vector Vector Map

pBLO 64.15559 bp60012001800240030003600420048005400tet operatorrrnB T1 terminatorT7Te terminatorp15A orilambda t0 terminatorCmRcat promoterTetRtetR/tetA promoters

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pBLO 64.1 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       62056_4095        5559 bp DNA     circular SYN 01-JAN-1980
DEFINITION  synthetic circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5559)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..5559
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    30..48
                     /label=tet operator
                     /note="bacterial operator O2 for the tetR and tetA genes"
     terminator      3069..3140
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      3156..3183
                     /label=T7Te terminator
                     /note="phage T7 early transcription terminator"
     rep_origin      complement(3345..3890)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     terminator      complement(4004..4098)
                     /label=lambda t0 terminator
                     /note="transcription terminator from phage lambda"
     CDS             complement(4122..4778)
                     /codon_start=1
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     promoter        complement(4779..4881)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             complement(4914..5537)
                     /codon_start=1
                     /label=TetR
                     /note="tetracycline repressor TetR"
                     /translation="MMSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWH
                     VKNKRALLDALAIEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGT
                     RPTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKEERETPT
                     TDSMPPLLRQAIELFDHQGAEPAFLFGLELIICGLEKQLKCESGS"
     promoter        5553..5559
                     /label=tetR/tetA promoters
                     /note="overlapping promoters for bacterial tetR and tetA"

This page is informational only.