Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V017486 | pUCDM | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pUCDM
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 2982 bp
- Type:
- Protein expression
- Replication origin:
- R6K γ ori
- Host:
- Insect cells
- Promoter:
- p10
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
pUCDM vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pUCDM vector Sequence
LOCUS 62056_22340 2982 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 2982) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..2982 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(86..474) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" protein_bind complement(495..528) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." polyA_signal complement(718..766) /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" promoter complement(902..1011) /label=p10 promoter /note="baculovirus promoter for expression in insect cells" promoter 1056..1147 /label=polyhedrin promoter /note="promoter for the baculovirus polyhedrin gene" polyA_signal 1406..1540 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" terminator 1626..1673 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" promoter 1911..2013 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 2014..2670 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"