pUCDM vector (V017486)

Basic Vector Information

      • Vector Name:
      • pUCDM
      • Antibiotic Resistance:
      • Chloramphenicol
      • Length:
      • 2982 bp
      • Type:
      • Protein expression
      • Replication origin:
      • R6K γ ori
      • Host:
      • Insect cells
      • Promoter:
      • p10
      • Growth Strain(s):
      • DH5a
      • Growth Temperature:
      • 37℃

pUCDM vector Vector Map

pUCDM2982 bp600120018002400R6K gamma oriloxPHSV TK poly(A) signalp10 promoterpolyhedrin promoterSV40 poly(A) signalT7 terminatorcat promoterCmR

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pUCDM vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       62056_22340        2982 bp DNA     circular SYN 01-JAN-1980
DEFINITION  synthetic circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 2982)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..2982
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(86..474)
                     /direction=LEFT
                     /label=R6K gamma ori
                     /note="gamma replication origin from E. coli plasmid R6K;
                     requires the R6K initiator protein pi for replication"
     protein_bind    complement(495..528)
                     /label=loxP
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (ATGTATGC) (Shaw et al., 2021)."
     polyA_signal    complement(718..766)
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase
                     polyadenylation signal (Cole and Stacy, 1985)"
     promoter        complement(902..1011)
                     /label=p10 promoter
                     /note="baculovirus promoter for expression in insect cells"
     promoter        1056..1147
                     /label=polyhedrin promoter
                     /note="promoter for the baculovirus polyhedrin gene"
     polyA_signal    1406..1540
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     terminator      1626..1673
                     /label=T7 terminator
                     /note="transcription terminator for bacteriophage T7 RNA 
                     polymerase"
     promoter        1911..2013
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             2014..2670
                     /codon_start=1
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"

This page is informational only.