pOBCol3.6-GFPtpz vector (V017483)

Basic Vector Information

      • Vector Name:
      • pOBCol3.6-GFPtpz
      • Antibiotic Resistance:
      • Chloramphenicol
      • Length:
      • 9671 bp
      • Type:
      • Protein expression
      • Replication origin:
      • ori
      • Host:
      • Mammalian cells
      • Promoter:
      • Col1a1
      • Growth Strain(s):
      • DH5a
      • Growth Temperature:
      • 37℃

pOBCol3.6-GFPtpz vector Vector Map

pOBCol3.6-GFPtpz9671 bp4008001200160020002400280032003600400044004800520056006000640068007200760080008400880092009600CAP binding sitelac promoterlac operatorM13 revT3 promoterCol1a1SK primerTopaz YFPbGH poly(A) signalKS primerT7 promoterM13 fwdf1 oriAmpR promoterCmRcat promoterori

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pOBCol3.6-GFPtpz vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       62056_18265        9671 bp DNA     circular SYN 01-JAN-1980
DEFINITION  synthetic circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9671)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..9671
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    867..888
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        903..933
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    941..957
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     965..981
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        1002..1020
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     promoter        1063..4693
                     /label=Col1a1
                     /note="Rat collagen type I alpha-1 promoter"
     primer_bind     6294..6310
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             6383..7099
                     /codon_start=1
                     /label=Topaz YFP
                     /note="enhanced yellow variant of GFP"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KFICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMRQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLL
                     EFVTAAGITLGMDELYK"
     polyA_signal    7139..7363
                     /label=bGH poly(A) signal
                     /note="bovine growth hormone polyadenylation signal"
     primer_bind     complement(7378..7394)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        complement(7420..7438)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(7448..7464)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     rep_origin      7606..8061
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        8087..8191
                     /label=AmpR promoter
     CDS             complement(8683..9339)
                     /codon_start=1
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPELRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     promoter        complement(9340..9442)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     rep_origin      9662..9671
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.