Price Information
Cat No. | Plasmid Name | Availability | Buy one, get one free! (?) |
---|---|---|---|
V017483 | pOBCol3.6-GFPtpz | In stock, 1 week for quality controls |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pOBCol3.6-GFPtpz
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 9671 bp
- Type:
- Protein expression
- Replication origin:
- ori
- Host:
- Mammalian cells
- Promoter:
- Col1a1
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
pOBCol3.6-GFPtpz vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pOBCol3.6-GFPtpz vector Sequence
LOCUS 62056_18265 9671 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9671) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..9671 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 867..888 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 903..933 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 941..957 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 965..981 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 1002..1020 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" promoter 1063..4693 /label=Col1a1 /note="Rat collagen type I alpha-1 promoter" primer_bind 6294..6310 /label=SK primer /note="common sequencing primer, one of multiple similar variants" CDS 6383..7099 /codon_start=1 /label=Topaz YFP /note="enhanced yellow variant of GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMRQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" polyA_signal 7139..7363 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" primer_bind complement(7378..7394) /label=KS primer /note="common sequencing primer, one of multiple similar variants" promoter complement(7420..7438) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(7448..7464) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin 7606..8061 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 8087..8191 /label=AmpR promoter CDS complement(8683..9339) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPELRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(9340..9442) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin 9662..9671 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"