Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V016835 | pMaster3 | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pMaster3
- Antibiotic Resistance:
- Ampicillin
- Length:
- 24152 bp
- Type:
- Protein expression, Stem cell reprogramming
- Replication origin:
- ori
- Host:
- Mammalian cells
- Selection Marker:
- Neo/G418
- Promoter:
- CAG
- Growth Strain(s):
- Stbl3
- Growth Temperature:
- 37℃
pMaster3 vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pMaster3 vector Sequence
LOCUS 62056_16510 24152 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 24152) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..24152 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 54..357 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 359..636 /label=chicken beta-actin promoter intron 637..1653 /label=chimeric intron /note="chimera between introns from chicken beta-actin and rabbit beta-globin" CDS 1722..2636 /codon_start=1 /label=hNanog /note="Homo sapiens nanog homeobox gene. Encodes a DNA-binding homeobox-family transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency." /translation="MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEM PHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSS TQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSN GVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWN TQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTT RYFSTPQTMDLFLNYSMNMQPEDV" CDS 2646..2711 /codon_start=1 /label=F2A /note="2A peptide from foot-and-mouth disease virus polyprotein" /translation="VKQTLNFDLLKLAGDVESNPGP" CDS 2712..3338 /codon_start=1 /label=hLIN28A /note="Human lin-28 homolog A gene. Encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in development, self-renewal of embryonic stem cells and metabolism. Overexpressed in human embryonic stem cells, primary human tumors and human cancer cell lines." /translation="MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICK WFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGL ESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHF CQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN" rep_origin complement(3523..4111) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4285..5142) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(5143..5247) /label=AmpR promoter rep_origin 7371..9160 /label=oriP /note="Epstein-Barr virus oriP replication origin (Yates et al., 2000)" promoter 9655..9866 /label=EF-1-alpha core promoter /note="core promoter for human elongation factor EF-1-alpha" promoter 10000..11706 /label=CAG /note="CMV early enhancer fused to modified chicken beta-actin promoter" CDS 11983..13392 /codon_start=1 /label=hKLF4 /note="Homo sapiens Kruppel-like factor 4 (Klf4) gene. Belongs to the relatively large family of SP1-like transcription factors and is involved in the regulation of proliferation, differentiation, apoptosis and somatic cell reprogramming." /translation="MAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRL PPVLPGRPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSL THPPESVAATVSSSASASSSSSPSSSGPASAPSTCSFTYPIRAGNDPGVAPGGTGGGLL YGRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVL KASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGA GPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYP SFLPDQMQPQVPPLHYQELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYT KSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSR SDHLALHMKRHF" CDS 13456..14406 /codon_start=1 /label=hSOX2 /note="Homo sapiens transcription factor SOX-2 gene. Belongs to the SRY-related HMG-box (SOX) family of transcription factors, which is involved in the regulation of embryonic development and in the determination of cell fate" /translation="MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPM NAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKE HPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHM NGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPT YSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGA EVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM" CDS 14476..15792 /codon_start=1 /label=c-Myc /note="human c-Myc proto-oncogene" /translation="MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTE LLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPN PARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDS LLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGS PSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNR KCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKA TAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA" polyA_signal 15919..16040 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(16047..16502) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" intron 17211..18227 /label=chimeric intron /note="chimera between introns from chicken beta-actin and rabbit beta-globin" CDS 18300..19427 /codon_start=1 /label=HSV TK /note="herpes simplex virus thymidine kinase" /translation="MASYPGHQHASAFDQAARSRGHSNRRTALRPRRQQEATEVRPEQK MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQ HRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSSHAPPPALTLIFDR HPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQR PGERLDLAMLAAIRRVYGLLANTVRYLQCGGSWREDWGQLSGTAVPPQGAEPQSNAGPR PHIGDTLFTLFRAPELLAPNGDLYNVFAWALDVLAKRLRSMHVFILDYDQSPAGCRDAL LQLTSGMVQTHVTTPGSIPTICDLARTFAREMGEAN" CDS 20033..20833 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase from Tn5" /translation="MGSAIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQ GRPVLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQD LLSSHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDE EHQGLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQ DIALATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 21068..21115 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" promoter 21136..22314 /label=EF-1-alpha promoter /note="strong constitutive promoter for human elongation factor EF-1-alpha"