Basic Vector Information
- Vector Name:
- pNC-Green
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3963 bp
- Type:
- Plant binary expression vector
- Replication origin:
- pSa ori
- Source/Author:
- Yan P, Zeng Y, Shen W, Tuo D
pNC-Green vector Vector Map
pNC-Green vector Sequence
LOCUS 62056_17820 3963 bp DNA circular SYN 04-SEP-2019 DEFINITION Plant binary expression vector pNC-Green, complete sequence. ACCESSION MK896901 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3963) AUTHORS Yan P, Zeng Y, Shen W, Tuo D, Li X, Zhou P. TITLE Direct Submission JOURNAL Submitted (07-MAY-2019) Institute of Tropical Bioscience and Biotechnology, Chinese Academy of Tropical Agriculture Sciences, Xueyuan Road, Haikou, Hainan 571101, China REFERENCE 2 (bases 1 to 3963) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (07-MAY-2019) Institute of Tropical Bioscience and Biotechnology, Chinese Academy of Tropical Agriculture Sciences, Xueyuan Road, Haikou, Hainan 571101, China" FEATURES Location/Qualifiers source 1..3963 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 181..283 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 314..616 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" primer_bind complement(690..706) /label=SK primer /note="common sequencing primer, one of multiple similar variants" promoter complement(743..761) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(782..798) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(806..822) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(830..861) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(876..897) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." misc_feature 1136..1160 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" rep_origin complement(1251..1839) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2013..2825) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANVVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 3116..3551 /label=pSa ori /note="origin of replication from bacterial plasmid pSa" misc_feature 3686..3708 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA (truncated)" primer_bind 3877..3893 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 3900..3918 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 3944..3960 /label=KS primer /note="common sequencing primer, one of multiple similar variants"
This page is informational only.