Basic Vector Information
- Vector Name:
- pMK228
- Antibiotic Resistance:
- Streptomycin
- Length:
- 4588 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Hartsough LA, Kotlajich MV, Han B, Lin C-C.J.
pMK228 vector Map
pMK228 vector Sequence
LOCUS 62056_17020 4588 bp DNA circular SYN 27-JUL-2020 DEFINITION Cloning vector pMK228, complete sequence. ACCESSION MN617162 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4588) AUTHORS Hartsough LA, Kotlajich MV, Han B, Lin C-C.J., Gambill L, Wang MC, Tabor JJ. TITLE Optogenetic control of gut bacterial metabolism JOURNAL Unpublished REFERENCE 2 (bases 1 to 4588) AUTHORS Hartsough LA, Kotlajich MV, Han B, Lin C-C.J., Gambill L, Wang MC, Tabor JJ. TITLE Direct Submission JOURNAL Submitted (26-OCT-2019) Bioengineering, Rice University, 6500 Main St., Houston, TX 77030, USA REFERENCE 3 (bases 1 to 4588) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-OCT-2019) Bioengineering, Rice University, 6500 Main St., Houston, TX 77030, USA" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..4588 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 24..171 /note="specR promoter; from KD13" /regulatory_class="promoter" CDS 172..960 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" terminator 975..1069 /label=lambda t0 terminator /note="transcription terminator from phage lambda" rep_origin 1183..1728 /direction=RIGHT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." misc_feature 1984..2018 /label=constitutive promoter J23106 /note="constitutive promoter J23106" misc_feature 2019..2053 /label=B0034 /note="B0034" CDS 2054..4315 /codon_start=1 /transl_table=11 /product="CcaS" /label=CcaS /protein_id="QLL27773.1" /translation="MGKFLIPIEFVFLAIAMTCYLWHRQNQERRRIEISIKQQTQRERF INQITQHIRQSLNLETVLNTTVAEVKTLLQVDRVLIYRIWQDGTGSAITESVNANYPSI LGRTFSDEVFPVEYHQAYTKGKVRAINDIDQDDIEICLADFVKQFGVKSKLVVPILQHN RASSLDNESEFPYLWGLLITHQCAFTRPWQPWEVELMKQLANQVAIAIQQSELYEQLQQ LNKDLENRVEKRTQQLAATNQSLRMEISERQKTEAALRHTNHTLQSLIAASPRGIFTLN LADQIQIWNPTAERIFGWTETEIIAHPELLTSNILLEDYQQFKQKVLSGMVSPSLELKC QKKDGSWIEIVLSAAPLLDSEENIAGLVAVVADITEQKRQAEQIRLLQSVVVNTNDAVV ITEAEPIDDPGPRILYVNEAFTKITGYTAEEMLGKTPRVLQGPKTSRTELDRVRQAISQ WQSVTVEVINYRKDGSEFWVEFSLVPVANKTGFYTHWIAVQRDVTERRRTEEVRLALER EKELSRLKTRFFSMASHEFRTPLSTALAAAQLLENSEVAWLDPDKRSRNLHRIQNSVKN MVQLLDDILIINRAEAGKLEFNPNWLDLKLLFQQFIEEIQLSVSDQYYFDFICSAQDTK ALVDERLVRSILSNLLSNAIKYSPGGGQIKIALSLDSEQIIFEVTDQGIGISPEDQKQI FEPFHRGKNVRNITGTGLGLMVAKKCVDLHSGSILLKSAVDQGTTVTICLKRYNHLPRA " terminator 4336..4407 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 4423..4450 /label=T7Te terminator /note="phage T7 early transcription terminator"
This page is informational only.