Basic Vector Information
- Vector Name:
- p15A-RBS1-A118
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3947 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Guo L.
p15A-RBS1-A118 vector Map
p15A-RBS1-A118 vector Sequence
LOCUS 62056_1875 3947 bp DNA circular SYN 16-MAY-2020 DEFINITION Cloning vector p15A-RBS1-A118, complete sequence. ACCESSION MN623121 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3947) AUTHORS Guo L. TITLE Direct Submission JOURNAL Submitted (28-OCT-2019) Jiangnan University, State Key Laboratory of Food Science and Technology, 1800 Lihu Avenue, Wuxi, Jiangsu 214122, China REFERENCE 2 (bases 1 to 3947) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (28-OCT-2019) Jiangnan University, State Key Laboratory of Food Science and Technology, 1800 Lihu Avenue, Wuxi, Jiangsu 214122, China" FEATURES Location/Qualifiers source 1..3947 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(10..633) /label=TetR /note="tetracycline repressor TetR" promoter 649..704 /label=tetR/tetA promoters /note="overlapping promoters for bacterial tetR and tetA" gene 730..2088 /gene="a118" /label=a118 CDS 730..2088 /codon_start=1 /transl_table=11 /gene="a118" /product="A118 serine recombinase" /label=a118 /note="A118" /protein_id="QJR97832.1" /translation="MKAAIYIRVSTQEQVENYSIQAQTEKLTGLCRSKDWDVYDIFIDG GYSGSNMNRPALNEMLSKLHEIDAVVVYRLDRLSRSQRDTITLIEEYFLKNNVEFVSLS ETLDTSSPFGRAMIGILSVFAQLERETIRDRMVMGKIKRIEAGLPLTTAKGRTFGYDVI DTKLYINEEEAKQLQLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGY VSYKDKVHVKGIHEPIISEEQFYRVQEIFTRMGKNPNMNRDSASLLNNLVVCSKCGLGF VHRRKDTMSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIINRVNNYSFASR NVDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYESQIEA NEELKKNKKIQENLADLATVDFDSLEFREKQLYLKSLINKIYIDGEQVTIEWL" terminator 2112..2183 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 2199..2226 /label=T7Te terminator /note="phage T7 early transcription terminator" rep_origin complement(2388..2933) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." terminator complement(3047..3141) /label=lambda t0 terminator /note="transcription terminator from phage lambda" CDS complement(3165..3821) /label=CmR /note="chloramphenicol acetyltransferase" promoter complement(3822..3924) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase"
This page is informational only.