Basic Vector Information
- Vector Name:
- pLB1
- Antibiotic Resistance:
- Apramycin
- Length:
- 5755 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Li L.
pLB1 vector Map
pLB1 vector Sequence
LOCUS 62056_13705 5755 bp DNA circular SYN 12-MAY-2019 DEFINITION Cloning vector pLB1, complete sequence. ACCESSION MK159854 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5755) AUTHORS Li L. TITLE Direct Submission JOURNAL Submitted (09-NOV-2018) Key Laboratory of Synthetic Biology, Institute of Plant Physiology and Ecology, 300 Feng Lin Road, Shanghai, Shanghai 200032, China REFERENCE 2 (bases 1 to 5755) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (09-NOV-2018) Key Laboratory of Synthetic Biology, Institute of Plant Physiology and Ecology, 300 Feng Lin Road, Shanghai, Shanghai 200032, China" FEATURES Location/Qualifiers source 1..5755 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 433..449 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" regulatory complement(499..595) /regulatory_class="promoter" primer_bind complement(616..632) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(640..656) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(664..694) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(709..730) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(1018..1606) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 1859..2659 /label=ApmR /note="aminoglycoside 3-N-acetyltransferase type IV" CDS complement(3096..3464) /label=traJ /note="oriT-recognizing protein" oriT complement(3497..3606) /direction=LEFT /label=oriT /note="incP origin of transfer" misc_recomb 3795..3842 CDS 3899..5683 /codon_start=1 /transl_table=11 /product="phiBT1 integrase" /label=phiBT1 integrase /protein_id="QCO31437.1" /translation="MSPFIAPDVPEHLLDTVRVFLYARQSKGRSDGSDVSTEAQLAAGR ALVASRNAQGGARWVVAGEFVDVGRSGWDPNVTRADFERMMGEVRAGEGDVVVVNELSR LTRKGAHDALEIDNELKKHGVRFMSVLEPFLDTSTPIGVAIFALIAALAKQDSDLKAER LKGAKDEIAALGGVHSSSAPFGMRAVRKKVDNLVISVLEPDEDNPDHVELVERMAKMSF EGVSDNAIATTFEKEKIPSPGMAERRATEKRLASIKARRLNGAEKPIMWRAQTVRWILN HPAIGGFAFERVKHGKAHINVIRRDPGGKPLTPHTGILSGSKWLELQEKRSGKNLSDRK PGAEVEPTLLSGWRFLGCRICGGSMGQSQGGRKRNGDLAEGNYMCANPKGHGGLSVKRS ELDEFVASKVWARLRTADMEDEHDQAWIAAAAERFALQHDLAGVADERREQQAHLDNVR RSIKDLQADRKAGLYVGREELETWRSTVLQYRSYEAECTTRLAELDEKMNGSTRVPSEW FSGEDPTAEGGIWASWDVYERREFLSFFLDSVMVDRGRHPETKKYIPLKDRVTLKWAEL LKEEDEASEATERELAAL"
This page is informational only.