Basic Vector Information
- Vector Name:
- MCPyV
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8704 bp
- Type:
- Lentiviral expression vector
- Replication origin:
- ori
- Source/Author:
- Kervarrec T, Cheret J, Paus R, Houben R
- Promoter:
- EF-1α core
MCPyV vector Map
MCPyV vector Sequence
LOCUS V016552 8704 bp DNA circular SYN 06-SEP-2021 DEFINITION Exported. ACCESSION V016552 VERSION V016552 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8704) AUTHORS Kervarrec T, Cheret J, Paus R, Houben R, Schrama D. TITLE Transduction-induced overexpression of Merkel cell T antigens in human hair follicles induces formation of pathological cell clusters with Merkel cell carcinoma-like phenotype JOURNAL Exp Dermatol (2021) In press PUBMED 34386998 REFERENCE 2 (bases 1 to 8704) AUTHORS Schrama D, Houben R, Kervarrec T. TITLE Direct Submission JOURNAL Submitted (27-JUL-2021) Dermatology, University Hospital Wuerzburg, Josef-Schneider-Str. 2, Wuerzburg, Bavaria 97080, Deutschland REFERENCE 3 (bases 1 to 8704) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Exp Dermatol (2021) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-JUL-2021) Dermatology, University Hospital Wuerzburg, Josef-Schneider-Str. 2, Wuerzburg, Bavaria 97080, Deutschland" FEATURES Location/Qualifiers source 1..8704 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 6..233 /label="RSV promoter" /note="Rous sarcoma virus enhancer/promoter" LTR 234..414 /label="5' LTR (truncated)" /note="truncated 5' long terminal repeat (LTR) from HIV-1" misc_feature 458..583 /label="HIV-1 Psi" /note="packaging signal of human immunodeficiency virus type 1" misc_feature 1076..1309 /label="RRE" /note="The Rev response element (RRE) of HIV-1 allows for Rev-dependent mRNA export from the nucleus to the cytoplasm." CDS 1493..1537 /label="gp41 peptide" /note="antigenic peptide corresponding to amino acids 655 to 669 of the HIV envelope protein gp41 (Lutje Hulsik et al., 2013)" CDS 1686..1727 /note="Protein Tat from Human immunodeficiency virus type 1 group M subtype B (isolate WMJ22). Accession#: P12509" /label="Protein Tat" misc_feature 1804..1920 /label="cPPT/CTS" /note="central polypurine tract and central termination sequence of HIV-1" promoter 2010..2213 /label="CMV promoter" /note="human cytomegalovirus (CMV) immediate early promoter" CDS join(2299..2532,2964..3632) /codon_start=1 /transl_table=11 /product="truncated MCPyV LT" /label="truncated MCPyV LT" /note="MCPyV LT 300" /protein_id="QZR95626.1" /translation="MDLVLNRKEREALCKLLEIAPNCYGNIPLMKAAFKRSCLKHHPDK GGNPVIMMELNTLWSKFQQNIHKLRSDFSMFDEVDEAPIYGTTKFKEWWRSGGFSFGKA YEYGPNPHGTNSRSRKPSSNASRGAPSGSSPPHSQSSSSGYGSFSASQASDSQSRGPDI PPEHHEEPTSSSGSSSREETTNSGRESSTPNGTSVPRNSSRTDGTWEDLFCDESLSSPE PPSSSEEPEEPPSSRSSPRQPPSSSAEEASSSQFTDEEYRSSSFTTPKTPPPFSRKRKF GGSRSSASSASSASSTSTP" CDS 2299..2859 /codon_start=1 /transl_table=11 /product="small T antigen" /label="small T antigen" /note="MCPyV small T antigen; sT" /protein_id="QZR95627.1" /translation="MDLVLNRKEREALCKLLEIAPNCYGNIPLMKAAFKRSCLKHHPDK GGNPVIMMELNTLWSKFQQNIHKLRSDFSMFDEVSTKFPWEEYGTLKDYMQSGYNARFC RGPGCMLKQLRDSKCACISCKLSRQHCSLKTLKQKNCLTWGECFCYQCFILWFGFPPTW ESFDWWQKTLEETDYCLLHLHLF" promoter 3674..3885 /label="EF-1-alpha core promoter" /note="core promoter for human elongation factor EF-1-alpha" LTR 3898..4166 /label="5' LTR (truncated)" /note="truncated 5' long terminal repeat (LTR) from human T-cell leukemia virus (HTLV) type 1" CDS 4193..4789 /label="PuroR" /note="puromycin N-acetyltransferase" misc_feature 4799..5387 /label="WPRE" /note="woodchuck hepatitis virus posttranscriptional regulatory element" LTR 5461..5694 /label="3' LTR (Delta-U3)" /note="self-inactivating 3' long terminal repeat (LTR) from HIV-1" polyA_signal 5766..5900 /label="SV40 poly(A) signal" /note="SV40 polyadenylation signal" rep_origin 5906..6041 /label="SV40 ori" /note="SV40 origin of replication" primer_bind complement(6079..6095) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(6103..6119) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(6127..6157) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(6172..6193) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(6481..7069) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7243..8100) /label="AmpR" /note="beta-lactamase" promoter complement(8101..8205) /label="AmpR promoter" primer_bind 8679..8695 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants"
This page is informational only.