Basic Vector Information
- Vector Name:
- pLM099-Venus
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5356 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Emrich-Mills TZ, Yates G, Barrett J, Girr P
pLM099-Venus vector Vector Map
pLM099-Venus vector Sequence
LOCUS 62056_14330 5356 bp DNA circular SYN 28-MAR-2021 DEFINITION Cloning vector pLM099-Venus, complete sequence. ACCESSION MT737960 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5356) AUTHORS Emrich-Mills TZ, Yates G, Barrett J, Girr P, Grouneva I, Lau CS, Walker CE, Kwok TK, Davey JW, Johnson MP, Mackinder LCM. TITLE A recombineering pipeline to clone large and complex genes in Chlamydomonas JOURNAL Plant Cell (2021) In press PUBMED 33723601 REFERENCE 2 (bases 1 to 5356) AUTHORS Emrich-Mills TZ, Yates G, Barrett J, Grouneva I, Lau CS, Walker CE, Kwok TK, Davey JW, Johnson MP, Mackinder LCM. TITLE Direct Submission JOURNAL Submitted (08-JUL-2020) Molecular Biology and Biotechnology, University of Sheffield, Western Bank, Sheffield, South Yorkshire S10 2TN, United Kingdom REFERENCE 3 (bases 1 to 5356) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant Cell (2021) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (08-JUL-2020) Molecular Biology and Biotechnology, University of Sheffield, Western Bank, Sheffield, South Yorkshire S10 2TN, United Kingdom" FEATURES Location/Qualifiers source 1..5356 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 28..744 /label=Venus /note="yellow fluorescent protein (YFP) with fast and efficient maturation (Nagai et al., 2002)" CDS 796..819 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" CDS 1917..2720 /codon_start=1 /transl_table=11 /product="APHVIII" /label=APHVIII /note="paromomycin resistance marker" /protein_id="QTE34478.1" /translation="MDDALRALRGRYPGCEWVVVEDGASGAGVYRLRGGGRELFVKVAA LGAGVGLLGEAERLVWLAEVGIPVPRVVEGGGDERVAWLVTEAVPGRPASARWPREQRL DVAVALAGLARSLHALDWERCPFDRSLAVTVPQAARAVAEGSVDLEDLDEERKGWSGER LLAELERTRPADEDLAVCHGDLCPDNVLLDPRTCEVTGLIDVGRVGRADRHSDLALVLR ELAHEEDPWFGPECSAAFLREYGRGWDGAVSEEKLAFYRLLDEFF" rep_origin 3093..3638 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS complement(3737..4549) /label=KanR /note="aminoglycoside phosphotransferase" CDS 4999..5301 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase"
This page is informational only.