pLM099-Venus vector (V016539)

LOCUS       62056_14330        5356 bp DNA     circular SYN 28-MAR-2021
DEFINITION  Cloning vector pLM099-Venus, complete sequence.
ACCESSION   MT737960
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5356)
  AUTHORS   Emrich-Mills TZ, Yates G, Barrett J, Girr P, Grouneva I, Lau CS, 
            Walker CE, Kwok TK, Davey JW, Johnson MP, Mackinder LCM.
  TITLE     A recombineering pipeline to clone large and complex genes in 
            Chlamydomonas
  JOURNAL   Plant Cell (2021) In press
  PUBMED    33723601
REFERENCE   2  (bases 1 to 5356)
  AUTHORS   Emrich-Mills TZ, Yates G, Barrett J, Grouneva I, Lau CS, Walker CE, 
            Kwok TK, Davey JW, Johnson MP, Mackinder LCM.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUL-2020) Molecular Biology and Biotechnology, 
            University of Sheffield, Western Bank, Sheffield, South Yorkshire 
            S10 2TN, United Kingdom
REFERENCE   3  (bases 1 to 5356)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plant Cell 
            (2021) In press"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (08-JUL-2020) Molecular Biology and Biotechnology, University of 
            Sheffield, Western Bank, Sheffield, South Yorkshire S10 2TN, United 
            Kingdom"
FEATURES             Location/Qualifiers
     source          1..5356
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             28..744
                     /label=Venus
                     /note="yellow fluorescent protein (YFP) with fast and
                     efficient maturation (Nagai et al., 2002)"
     CDS             796..819
                     /label=FLAG
                     /note="FLAG(R) epitope tag, followed by an enterokinase
                     cleavage site"
     CDS             1917..2720
                     /codon_start=1
                     /transl_table=11
                     /product="APHVIII"
                     /label=APHVIII
                     /note="paromomycin resistance marker"
                     /protein_id="QTE34478.1"
                     /translation="MDDALRALRGRYPGCEWVVVEDGASGAGVYRLRGGGRELFVKVAA
                     LGAGVGLLGEAERLVWLAEVGIPVPRVVEGGGDERVAWLVTEAVPGRPASARWPREQRL
                     DVAVALAGLARSLHALDWERCPFDRSLAVTVPQAARAVAEGSVDLEDLDEERKGWSGER
                     LLAELERTRPADEDLAVCHGDLCPDNVLLDPRTCEVTGLIDVGRVGRADRHSDLALVLR
                     ELAHEEDPWFGPECSAAFLREYGRGWDGAVSEEKLAFYRLLDEFF"
     rep_origin      3093..3638
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             complement(3737..4549)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     CDS             4999..5301
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"