Basic Vector Information
- Vector Name:
- pFA-3xGFP-URA3-Clox
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9185 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Duenas-Santero E, Santos-Almeida A, Rojo-Dominguez P, del Rey F
- Promoter:
- T7
pFA-3xGFP-URA3-Clox vector Map
pFA-3xGFP-URA3-Clox vector Sequence
LOCUS V016521 9185 bp DNA circular SYN 17-JUL-2019 DEFINITION Exported. ACCESSION V016521 VERSION V016521 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9185) AUTHORS Duenas-Santero E, Santos-Almeida A, Rojo-Dominguez P, del Rey F, Correa-Bordes J, Vazquez de Aldana CR. TITLE A new toolkit for gene tagging in Candida albicans containing recyclable markers JOURNAL PLoS ONE (2019) In press REFERENCE 2 (bases 1 to 9185) AUTHORS Duenas-Santero E, Santos-Almeida A, Rojo-Dominguez P, del Rey F, Correa-Bordes J, Vazquez de Aldana CR. TITLE Direct Submission JOURNAL Submitted (18-MAR-2019) Instituto de Biologia Funcional y Genomica (IBFG), Consejo Superior de Investigaciones Cientificas, Zacarias Gonzalez 2, Salamanca, Salamanca 37007, Spain REFERENCE 3 (bases 1 to 9185) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Assembly Method :: Lasergene v. 12 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE (2019) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-MAR-2019) Instituto de Biologia Funcional y Genomica (IBFG), Consejo Superior de Investigaciones Cientificas, Zacarias Gonzalez 2, Salamanca, Salamanca 37007, Spain" FEATURES Location/Qualifiers source 1..9185 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 62..772 /label="GFP" /note="green fluorescent protein" regulatory 2210..2465 /note="Transcriptional termination from Saccharomyces cerevisiae URA3 gene" /regulatory_class="terminator" primer_bind 2475..2491 /label="SK primer" /note="common sequencing primer, one of multiple similar variants" misc_feature 2505..2538 /product="loxP" CDS 2968..3777 /gene="URA3" /label="Orotidine 5'-phosphate decarboxylase" /note="Orotidine 5'-phosphate decarboxylase from Candida albicans (strain SC5314 / ATCC MYA-2876). Accession#: P13649" regulatory 3922..5253 /note="CaMET3 promoter; inducible upon growth without methionine repressible via addition of methionine and cysteine to the medium" /regulatory_class="promoter" CDS join(5281..5684,5849..6476) /codon_start=1 /transl_table=11 /product="Cre" /label="Cre" /note="Cre recombinase" /protein_id="QDK59728.1" /translation="MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKML LSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGL PRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAF LGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVE RWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQ RYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNIVMNYIRNLDSETGAMVRLLE DGD" intron 5685..5848 /note="modified TUB2 intron sequence" 3'UTR 6489..6619 /label="Saccharomyces cerevisiae ADH1 3'UTR region" /note="Saccharomyces cerevisiae ADH1 3'UTR region" regulatory 6620..6679 /note="Transcriptional termination from Saccharomyces cerevisiae CYC1 gene" /regulatory_class="terminator" protein_bind complement(6692..6725) /label="loxP" /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." promoter complement(6823..6841) /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" rep_origin complement(7099..7687) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7861..8718) /label="AmpR" /note="beta-lactamase" promoter complement(8719..8823) /label="AmpR promoter" promoter 9169..9185 /label="SP6 promoter" /note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.