Basic Vector Information
- Vector Name:
- pBlu10-Htk
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5756 bp
- Type:
- Shuttle expression vector
- Replication origin:
- ori
- Source/Author:
- Le Y.
pBlu10-Htk vector Vector Map
pBlu10-Htk vector Sequence
LOCUS 62056_4115 5756 bp DNA circular SYN 30-SEP-2020 DEFINITION Shuttle expression vector pBlu10-Htk, complete sequence. ACCESSION MN843970 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5756) AUTHORS Le Y. TITLE Direct Submission JOURNAL Submitted (18-DEC-2019) School of Environment and Safety Engineering, Jiangsu University, Xuefu Road 301, Zhen Jiang, Jiangsu 212013, China REFERENCE 2 (bases 1 to 5756) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (18-DEC-2019) School of Environment and Safety Engineering, Jiangsu University, Xuefu Road 301, Zhen Jiang, Jiangsu 212013, China" FEATURES Location/Qualifiers source 1..5756 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 130..2505 /label=Gram-positive origin of replication /note="Gram-positive origin of replication" regulatory 2506..3047 /regulatory_class="promoter" gene 3048..3809 /gene="Htk" /label=Htk CDS 3048..3809 /codon_start=1 /transl_table=11 /gene="Htk" /product="kanamycin resistance protein" /label=Htk /protein_id="QOC69212.1" /translation="MKGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGRQTD GPYSDIEMMCVLSTEGVEFSYEWTTGEWKAEVNFYSEEILLDYASRVEPDWPLTHGRFF SILPIYDPGGYFEKVYQTAKSVEAQKFHDAICALIVEELFEYAGKWRNIRVQGPTTFLP SLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQPDLPPGYVQLCQLVMSGQLSDPEK LLESLENFWNGVQEWAERHGYIVDVSKRIPF" regulatory 3810..3832 /label=RBS /note="RBS" /regulatory_class="ribosome_binding_site" misc_feature 3836..3865 /label=MCS /note="MCS" regulatory 3866..3923 /regulatory_class="terminator" rep_origin complement(4009..4597) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4771..5628) /label=AmpR /note="beta-lactamase" promoter complement(5629..5733) /label=AmpR promoter
This page is informational only.