Basic Vector Information
- Vector Name:
- pSKA562
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9414 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Aoki SK, Lillacci G, Gupta A, Baumschlager A
pSKA562 vector Map
pSKA562 vector Sequence
LOCUS V016485 9414 bp DNA circular SYN 26-JUN-2019
DEFINITION Exported.
ACCESSION V016485
VERSION V016485
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 9414)
AUTHORS Aoki SK, Lillacci G, Gupta A, Baumschlager A, Schweingruber D,
Khammash M.
TITLE A universal biomolecular integral feedback controller for robust
perfect adaptation
JOURNAL Nature 570, 533-537 (2019)
PUBMED 31217585
REFERENCE 2 (bases 1 to 9414)
AUTHORS Aoki SK, Lillacci G.
TITLE Direct Submission
JOURNAL Submitted (09-APR-2019) Biosystems Science and Engineering, ETH
Zurich, Mattenstrasse 26, Basel 4058, Switzerland
REFERENCE 3 (bases 1 to 9414)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nature 570,
533-537 (2019)"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(09-APR-2019) Biosystems Science and Engineering, ETH Zurich,
Mattenstrasse 26, Basel 4058, Switzerland"
FEATURES Location/Qualifiers
source 1..9414
/mol_type="other DNA"
/organism="synthetic DNA construct"
regulatory 26..47
/label="UP element"
/note="UP element"
/regulatory_class="enhancer"
regulatory 50..85
/label="PsigW"
/note="PsigW"
/regulatory_class="promoter"
regulatory 112..118
/label="sRBS"
/note="sRBS"
/regulatory_class="ribosome_binding_site"
CDS 128..169
/label="V5 tag"
/note="epitope tag from simian virus 5"
CDS 176..1048
/label="araC"
/note="L-arabinose regulatory protein"
regulatory 1139..1145
/label="sRBS"
/note="sRBS"
/regulatory_class="ribosome_binding_site"
CDS 1155..1178
/label="FLAG"
/note="FLAG(R) epitope tag, followed by an enterokinase
cleavage site"
CDS 1191..1901
/label="superfolder GFP"
/note="GFP variant that folds robustly even when fused to
poorly folded proteins (Pedelacq et al., 2006)"
terminator 2206..2292
/label="rrnB T1 terminator"
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 2384..2411
/label="rrnB T2 terminator"
/note="transcription terminator T2 from the E. coli rrnB
gene"
regulatory 2494..2515
/label="UP element"
/note="UP element"
/regulatory_class="enhancer"
regulatory 2518..2553
/label="PsigW"
/note="PsigW"
/regulatory_class="promoter"
regulatory 2580..2586
/label="sRBS"
/note="sRBS"
/regulatory_class="ribosome_binding_site"
CDS 2596..2637
/label="V5 tag"
/note="epitope tag from simian virus 5"
CDS 2644..3516
/label="araC"
/note="L-arabinose regulatory protein"
regulatory 3607..3613
/label="sRBS"
/note="sRBS"
/regulatory_class="ribosome_binding_site"
CDS 3623..3646
/label="FLAG"
/note="FLAG(R) epitope tag, followed by an enterokinase
cleavage site"
CDS 3659..4369
/label="superfolder GFP"
/note="GFP variant that folds robustly even when fused to
poorly folded proteins (Pedelacq et al., 2006)"
regulatory 4472..4897
/label="rrnB T1T2 terminator"
/note="rrnB T1T2 terminator"
/regulatory_class="terminator"
terminator complement(4973..5020)
/label="T7 terminator"
/note="transcription terminator for bacteriophage T7 RNA
polymerase"
CDS complement(5024..5773)
/gene="luxR"
/label="Transcriptional activator protein LuxR"
/note="Transcriptional activator protein LuxR from
Aliivibrio fischeri. Accession#: P12746"
regulatory complement(5802..5855)
/label="Pconstitutive"
/note="Pconstitutive"
/regulatory_class="promoter"
regulatory 5906..5970
/label="Plux"
/note="Plux"
/regulatory_class="promoter"
regulatory 5906..5925
/label="LuxR binding site"
/note="LuxR binding site"
/regulatory_class="other"
regulatory 5971..5996
/label="RBS5000"
/note="RBS5000"
/regulatory_class="ribosome_binding_site"
CDS 5997..6557
/gene="sigW"
/label="ECF RNA polymerase sigma factor SigW"
/note="ECF RNA polymerase sigma factor SigW from Bacillus
subtilis (strain 168). Accession#: Q45585"
regulatory 6572..6658
/label="rrnB T1 terminator"
/note="rrnB T1 terminator"
/regulatory_class="terminator"
regulatory 6685..6756
/label="PBAD"
/note="PBAD"
/regulatory_class="promoter"
regulatory 6685..6701
/label="AraC I1 binding site"
/note="AraC I1 binding site"
/regulatory_class="other"
regulatory 6706..6722
/label="AraC I2 binding site"
/note="AraC I2 binding site"
/regulatory_class="other"
regulatory 6772..6797
/label="RBS5000"
/note="RBS5000"
/regulatory_class="ribosome_binding_site"
CDS 6798..7061
/codon_start=1
/transl_table=11
/product="RsiW"
/label="RsiW"
/note="cytoplasmic RsiW domain"
/protein_id="QDD67922.1"
/translation="MSCPEQIVQLMHMHLDGDILPKDEHVLNEHLETCEKCRKHFYEME
KSIALVRSTSHVEAPADFTANVMAKLPKEKKRASVKRWFRTH"
terminator complement(7279..7322)
/label="rrnB T1 terminator"
/note="transcription terminator T1 from the E. coli rrnB
gene"
rep_origin complement(7585..8173)
/direction=LEFT
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
terminator complement(8261..8355)
/label="lambda t0 terminator"
/note="transcription terminator from phage lambda"
CDS complement(8388..9245)
/label="AmpR"
/note="beta-lactamase"
promoter complement(9246..9350)
/label="AmpR promoter"
This page is informational only.