pUC-2XproD vector (V016484)

LOCUS       62056_21835        4755 bp DNA     circular SYN 12-MAY-2021
DEFINITION  Cloning vector pUC-2XproD, complete genome.
ACCESSION   MT333853
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4755)
  AUTHORS   Velasco L.
  TITLE     An efficient dsRNA constitutive expression system for bacteria
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4755)
  AUTHORS   Velasco L.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-APR-2020) Plant Protection, Instituto Andaluz de 
            Investigacion y Formacion Agraria y Pesquera (IFAPA), Cortijo de la 
            Cruz s/n, Churriana, Malaga 29140, Spain
REFERENCE   3  (bases 1 to 4755)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (13-APR-2020) Plant Protection, Instituto Andaluz de Investigacion y
            Formacion Agraria y Pesquera (IFAPA), Cortijo de la Cruz s/n, 
            Churriana, Malaga 29140, Spain"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4755
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    106..127
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        142..172
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    180..196
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     204..220
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      258..416
                     /label=proD
                     /note="proD"
                     /regulatory_class="promoter"
     protein_bind    423..547
                     /label=attR1
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        572..602
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an 'up' mutation"
     gene            656..1336
                     /gene="cat"
                     /label=cat
     CDS             656..1336
                     /codon_start=1
                     /transl_table=11
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /label=cat
                     /protein_id="QUV72830.1"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNEYNSTAMSGRAGRKRV
                     DPAY"
     CDS             1655..1957
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
     protein_bind    complement(2001..2125)
                     /label=attR2
                     /note="recombination site for the Gateway(R) LR reaction"
     primer_bind     complement(2140..2156)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      complement(2173..2331)
                     /label=proD
                     /note="proD"
                     /regulatory_class="promoter"
     primer_bind     complement(2359..2375)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        2849..2953
                     /label=AmpR promoter
     CDS             2954..3811
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      3985..4573
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"