Basic Vector Information
- Vector Name:
- pUC-2XproD
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4755 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Velasco L.
pUC-2XproD vector Vector Map
pUC-2XproD vector Sequence
LOCUS 62056_21835 4755 bp DNA circular SYN 12-MAY-2021 DEFINITION Cloning vector pUC-2XproD, complete genome. ACCESSION MT333853 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4755) AUTHORS Velasco L. TITLE An efficient dsRNA constitutive expression system for bacteria JOURNAL Unpublished REFERENCE 2 (bases 1 to 4755) AUTHORS Velasco L. TITLE Direct Submission JOURNAL Submitted (13-APR-2020) Plant Protection, Instituto Andaluz de Investigacion y Formacion Agraria y Pesquera (IFAPA), Cortijo de la Cruz s/n, Churriana, Malaga 29140, Spain REFERENCE 3 (bases 1 to 4755) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-APR-2020) Plant Protection, Instituto Andaluz de Investigacion y Formacion Agraria y Pesquera (IFAPA), Cortijo de la Cruz s/n, Churriana, Malaga 29140, Spain" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..4755 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 106..127 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 142..172 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 180..196 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 204..220 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" regulatory 258..416 /label=proD /note="proD" /regulatory_class="promoter" protein_bind 423..547 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter 572..602 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" gene 656..1336 /gene="cat" /label=cat CDS 656..1336 /codon_start=1 /transl_table=11 /gene="cat" /product="chloramphenicol acetyltransferase" /label=cat /protein_id="QUV72830.1" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNEYNSTAMSGRAGRKRV DPAY" CDS 1655..1957 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" protein_bind complement(2001..2125) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" primer_bind complement(2140..2156) /label=KS primer /note="common sequencing primer, one of multiple similar variants" regulatory complement(2173..2331) /label=proD /note="proD" /regulatory_class="promoter" primer_bind complement(2359..2375) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 2849..2953 /label=AmpR promoter CDS 2954..3811 /label=AmpR /note="beta-lactamase" rep_origin 3985..4573 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.