Basic Vector Information
- Vector Name:
- pDU1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7971 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Niu T-C., Zhang J-Y., Zhang C-C.
pDU1 vector Vector Map
pDU1 vector Sequence
LOCUS 62056_8645 7971 bp DNA circular SYN 22-DEC-2019 DEFINITION Expression vector pDU1, complete sequence. ACCESSION MK948095 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7971) AUTHORS Niu T-C., Zhang J-Y., Zhang C-C. TITLE Tight Control of Gene Expression in Anabaena using a hybrid regulatory system consisting of a copper inducible promoter and a theophylline riboswitch JOURNAL Unpublished REFERENCE 2 (bases 1 to 7971) AUTHORS Niu T-C., Zhang J-Y., Zhang C-C. TITLE Direct Submission JOURNAL Submitted (15-MAY-2019) Center for Algal Biology and Applied Research, Institute of Hydrobiology, Donghu Nanlu, Wuhan, Hubei 430072, 086 REFERENCE 3 (bases 1 to 7971) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-MAY-2019) Center for Algal Biology and Applied Research, Institute of Hydrobiology, Donghu Nanlu, Wuhan, Hubei 430072, 086" FEATURES Location/Qualifiers source 1..7971 /mol_type="other DNA" /organism="synthetic DNA construct" source 3801..7971 /mol_type="other DNA" /db_xref="taxon:28072" /organism="Nostoc sp. PCC 7524" CDS 596..1387 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" misc_feature 1943..2083 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(2269..2857) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" regulatory 2952..2976 /label=terminator /note="terminator" /regulatory_class="terminator" regulatory 2983..3448 /note="petE; the promoter region(-475 to -9) of Anabaena petE (id:all0258) gene" /regulatory_class="promoter" regulatory 3455..3517 /label=theophylline riboswitch /note="theophylline riboswitch" /regulatory_class="ribosome_binding_site" misc_feature 3530..3568 /label=protein domain linker /note="protein domain linker" CDS 3563..3652 /label=Twin-Strep-tag /note="two Strep-Tag(R)II moieties connected by a linker for enhanced binding to Strep-Tactin(R), an engineered form of streptavidin (Schmidt et al., 2013)" CDS 3656..3673 /label=6xHis /note="6xHis affinity tag" terminator 3740..3787 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" gene 4878..5999 /gene="repA" /label=repA CDS 4878..5999 /codon_start=1 /transl_table=11 /gene="repA" /product="RepA" /label=repA /note="required for plasmid replication in cyanobacteria" /protein_id="QGX42291.1" /translation="MISPESLNTNVSLTLLTRELQTEIILGTYTVRVHTRIGREPCARL WYLCRALDKDGSGHLTLPLPVVQTFLDCSDKSVYRWLQDGKKIGAFRRYKIKAGMITVY LGGMFQVCYNLNLKRWGDVAVVPLVQVLSDLRSLTTGIVTQSFQQKSRYAANRQLKPEY RKLFGAPHPNELVKDTRQSSLKSPEGEVPCVLHISSSRIFVSKSFIHYGTSQKAVSCEL GIHKRTVRRHQKQLGMNRRQLCQAKIEYNQLRHARNNDASEFWAFTGTKTDIGYQVMGD AVVFSDGIAPGAKKRQPNTYQIDATEFDGRLFKVGDKVFMNRCNIYREQFTLTTMSAAR RKYHFKLSQCHFSENRAGRVGNRFVIGCHSGEI" CDS complement(6620..7171) /codon_start=1 /transl_table=11 /product="hypothetical protein" /label=hypothetical protein /note="required for plasmid replication in cyanobacteria" /protein_id="QGX42292.1" /translation="MKVNGNGRAKILTSDELRRLFSDGFTTPRDRVLFGICLFTGCRVS EALALQTTDIKGETLTFRKSTTKGKLKTRVVDIQPGLAALMADYHPKPGTLFPGMRGVS DRLTRYAADKILRDAAKRIGLEGISTHSFRRTALNQMSSAGIPLRHIQEISGHNDLGTL QRYLEVTPEQRRKAVSVIGF" CDS complement(7543..7896) /codon_start=1 /transl_table=11 /product="hypothetical protein" /label=hypothetical protein /note="required for plasmid replication in cyanobacteria" /protein_id="QGX42293.1" /translation="MADKTLATFRIDSEEWESFKNLASSESSNASALLTEFVRWYLAGN RFNTPTSHTPTHLDTSLEQRIDNIEQRLDKVTTNNLDNIDEFIDKRIEDNLATRLDKLQ SQLEELRGKSKAR"
This page is informational only.