Basic Vector Information
- Vector Name:
- pNC-RFP-C
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5464 bp
- Type:
- Plant binary expression vector
- Replication origin:
- pSa ori
- Host:
- Plants
- Source/Author:
- Yan P, Zeng Y, Shen W, Tuo D
- Promoter:
- CaMV35S(short)
pNC-RFP-C vector Map
pNC-RFP-C vector Sequence
LOCUS 62056_17845 5464 bp DNA circular SYN 07-OCT-2019 DEFINITION Plant binary expression vector pNC-RFP-C, complete sequence. ACCESSION MN055608 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5464) AUTHORS Yan P, Zeng Y, Shen W, Tuo D, Li X, Zhou P. TITLE Direct Submission JOURNAL Submitted (10-JUN-2019) Institute of Tropical Bioscience and Biotechnology, Chinese Academy of Tropical Agriculture Sciences, Xueyuan Road, Haikou, Hainan 571101, China REFERENCE 2 (bases 1 to 5464) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (10-JUN-2019) Institute of Tropical Bioscience and Biotechnology, Chinese Academy of Tropical Agriculture Sciences, Xueyuan Road, Haikou, Hainan 571101, China" FEATURES Location/Qualifiers source 1..5464 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 184..529 /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" promoter 725..827 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 858..1160 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" CDS 1221..1895 /codon_start=1 /label=mRFP1 /note="monomeric derivative of DsRed (Campbell et al., 2002)" /translation="MASSEDVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAK LKVTKGGPLPFAWDILSPQFQYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGV VTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASTERMYPEDGALKGEIKM RLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHS TGA" terminator 1921..2173 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" primer_bind complement(2191..2207) /label=SK primer /note="common sequencing primer, one of multiple similar variants" promoter complement(2244..2262) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(2283..2299) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2307..2323) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2331..2362) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2377..2398) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." misc_feature 2637..2661 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" rep_origin complement(2752..3340) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3514..4326) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANVVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 4617..5052 /label=pSa ori /note="origin of replication from bacterial plasmid pSa" misc_feature 5187..5209 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA (truncated)" primer_bind 5378..5394 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 5401..5419 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 5445..5461 /label=KS primer /note="common sequencing primer, one of multiple similar variants"
This page is informational only.