Basic Vector Information
- Vector Name:
- p15Tc-litR
- Antibiotic Resistance:
- Tetracycline
- Length:
- 5337 bp
- Type:
- Expression vector
- Replication origin:
- p15A ori
- Source/Author:
- Bazhenov S, Melkina O, Fomin V, Scheglova E
p15Tc-litR vector Vector Map
p15Tc-litR vector Sequence
LOCUS 62056_1880 5337 bp DNA circular SYN 31-OCT-2021 DEFINITION Expression vector p15Tc-litR, complete sequence. ACCESSION MZ683493 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5337) AUTHORS Bazhenov S, Melkina O, Fomin V, Scheglova E, Krasnik P, Khrulnova S, Zavilgelsky G, Manukhov I. TITLE LitR directly upregulates autoinducer synthesis and luminescence in Aliivibrio logei JOURNAL PeerJ 9, e12030 (2021) PUBMED 34616599 REFERENCE 2 (bases 1 to 5337) AUTHORS Bazhenov SV, Manukhov IV. TITLE Direct Submission JOURNAL Submitted (02-AUG-2021) Laboratory for Molecular Genetics, Moscow Institute of Physics and Technology, Pervomayskaya, 3, Dolgoprudny, Moscow Region 141701, Russia REFERENCE 3 (bases 1 to 5337) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PeerJ 9, e12030 (2021)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-AUG-2021) Laboratory for Molecular Genetics, Moscow Institute of Physics and Technology, Pervomayskaya, 3, Dolgoprudny, Moscow Region 141701, Russia" FEATURES Location/Qualifiers source 1..5337 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 19..39 /label=Ptac sequencing primer /note="Ptac sequencing primer" promoter 183..211 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 219..235 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." gene 258..863 /gene="litR" /label=litR /note="derived from Aliivibrio logei" CDS 258..863 /codon_start=1 /transl_table=11 /gene="litR" /product="LitR family transcriptional regulator" /label=litR /protein_id="UDM84365.1" /translation="METIQKRPRTRLSPEKRKEQLLDIAIEVFSQRGIGRGGHADIAEI AQVSVATVFNYFPTREDLVDDVLNRVEEQFHNFILNSISLDRDVRSNLHSLLVNIIDTV QMDNKWIKVWFEWSTSTREEVWPLFLSTQVNNQKVIHDMFAEGIERNEVCNDHTPENLA KMLHGICYSVFIQANRNSSYEELEQTANCFLNMLCIYK" rep_origin complement(1278..1823) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." promoter 1935..1963 /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" CDS 2011..3198 /label=TcR /note="tetracycline efflux protein" promoter 3608..3685 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 3686..4765 /label=lacI /note="lac repressor" protein_bind 4781..4802 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 4817..4847 /label=lac promoter /note="promoter for the E. coli lac operon" CDS 4891..5064 /label=lacZ-alpha /note="LacZ-alpha fragment of beta-galactosidase"
This page is informational only.