Basic Vector Information
- Vector Name:
- pCF
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 8800 bp
- Type:
- Expression vector
- Replication origin:
- p15A ori
- Source/Author:
- Fang L, Fan J, Luo S, Chen Y
pCF vector Vector Map
pCF vector Sequence
LOCUS 62056_6220 8800 bp DNA circular SYN 18-AUG-2021 DEFINITION Expression vector pCF, complete sequence. ACCESSION MZ567118 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8800) AUTHORS Fang L, Fan J, Luo S, Chen Y, Wang C, Cao Y, Song H. TITLE Genome-scale target identification in Escherichia coli for high-titer production of free fatty acids JOURNAL Nat Commun 12 (1), 4976 (2021) REFERENCE 2 (bases 1 to 8800) AUTHORS Fang L, Fan J, Luo S, Chen Y, Wang C, Cao Y, Song H. TITLE Direct Submission JOURNAL Submitted (13-JUL-2021) School of Chemical Engineering, Tianjin University, No. 135, Yaguan Road, Haihe Education Park, Jinnan District, Tianjin, Tian Jin, Tian Jin 300350, China REFERENCE 3 (bases 1 to 8800) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun"; date: "2021"; volume: "12"; issue: "1"; pages: "4976" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-JUL-2021) School of Chemical Engineering, Tianjin University, No. 135, Yaguan Road, Haihe Education Park, Jinnan District, Tianjin, Tian Jin, Tian Jin 300350, China" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..8800 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(120..776) /label=CmR /note="chloramphenicol acetyltransferase" promoter complement(777..879) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin complement(1405..1949) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." protein_bind complement(2140..2161) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(2177..3256) /label=lacI /note="lac repressor" promoter complement(3257..3334) /label=lacI promoter promoter 3405..3434 /label=trc promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 3442..3458 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." misc_feature 3475..3544 /label=rrnG antiterminator /note="antiterminator from the E. coli rrnG leader region (Berg et al., 1989)" CDS 3595..3618 /label=minicistron /note="synthetic cistron containing a ribosome binding site (Shine-Dalgarno sequence), for enhancing the bacterial expression of a downstream cistron (Schoner, 1997)" CDS 3625..7728 /label=dCas9 /note="catalytically dead mutant of the Cas9 endonuclease from the Streptococcus pyogenes Type II CRISPR/Cas system" terminator 7780..7826 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" promoter 7898..7916 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 7917..7941 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." gene 7984..8535 /gene="tesA'" /label=tesA' CDS 7984..8535 /codon_start=1 /transl_table=11 /gene="tesA'" /product="TesA'" /label=tesA' /note="truncated fatty acyl-ACP thioesterase TesA" /protein_id="QXV67745.1" /translation="MADTLLILGDSLSAGYRMSASAAWPALLNDKWQSKTSVVNASISG DTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQDVKAANAEPL LMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDDGIHPNRDA QPFIADWMAKQLQPLVNHDS" CDS 8554..8598 /label=S-Tag /note="affinity and epitope tag derived from pancreatic ribonuclease A" terminator 8650..8697 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase"
This page is informational only.