Basic Vector Information
- Vector Name:
- pJV298-Tyr1
- Length:
- 5295 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Lee MS, Hung CS, Phillips DA, Buck CC
pJV298-Tyr1 vector Vector Map
pJV298-Tyr1 vector Sequence
LOCUS 62056_13245 5295 bp DNA circular SYN 22-JUL-2020 DEFINITION Cloning vector pJV298-Tyr1, complete sequence. ACCESSION MT346028 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5295) AUTHORS Lee MS, Hung CS, Phillips DA, Buck CC, Gupta MK, Lux MW. TITLE Silk fibroin as an additive for cell-free protein synthesis JOURNAL Synth Syst Biotechnol 5 (3), 145-154 (2020) PUBMED 32637668 REFERENCE 2 (bases 1 to 5295) AUTHORS Lee MS. TITLE Direct Submission JOURNAL Submitted (16-APR-2020) US Army CCDC Chemical Biological Center, 8567 Ricketts Point Road, Gunpowder, MD 21010, USA REFERENCE 3 (bases 1 to 5295) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Synth Syst Biotechnol"; date: "2020"; volume: "5"; issue: "3"; pages: "145-154" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (16-APR-2020) US Army CCDC Chemical Biological Center, 8567 Ricketts Point Road, Gunpowder, MD 21010, USA" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5295 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(1..546) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS complement(770..1849) /label=lacI /note="lac repressor" promoter complement(1850..1927) /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." promoter 2161..2189 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 2197..2213 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." gene 2277..3170 /gene="tyr1" /label=tyr1 CDS 2277..3170 /codon_start=1 /transl_table=11 /gene="tyr1" /product="tyrosinase" /label=tyr1 /note="Tyr1 tyrosinase; derived from Bacillus megaterium" /protein_id="QLI61466.1" /translation="MGNKYRVRKNVLHLTDTEKRDFVRTVLILKEKGIYDRYIAWHGAA GKFHTPPGSDRNAAHMSSAFLPWHREYLLRFERDLQSINPEVTLPYWEWETDAQMQDPS QSQIWSADFMGGNGNPIKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAPTLP TRDDVLNALKITQYDTPPWDMTSQNSFRNQLEGFINGPQLHNRVHRWVGGQMGVVPTAP NDPVFFLHHANVDRIWAVWQIIHRNQNYQPMKNGPFGQNFRDPMYPWNTTPEDVMNHRK LGYVYDIELRKSKRSS" oriT 3587..3696 /label=oriT /note="incP origin of transfer" gene complement(4103..4741) /gene="cat" /label=cat CDS complement(4103..4741) /codon_start=1 /transl_table=11 /gene="cat" /product="Cat" /label=cat /note="chloramphenicol acetyltransferase" /protein_id="QLI61467.1" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPELRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRCLMNTTVLR" promoter complement(4742..4844) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase"
This page is informational only.