Basic Vector Information
- Vector Name:
- pMTL675555
- Length:
- 7997 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Lau MSH., Sheng L, Zhang Y, Minton NP.
pMTL675555 vector Vector Map
pMTL675555 vector Sequence
LOCUS V016399 7997 bp DNA circular SYN 28-JUL-2021 DEFINITION Exported. ACCESSION V016399 VERSION V016399 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 7997) AUTHORS Lau MSH., Sheng L, Zhang Y, Minton NP. TITLE Development of a Suite of Tools for Genome Editing in Parageobacillus thermoglucosidasius and Their Use to Identify the Potential of a Native Plasmid in the Generation of Stable Engineered Strains JOURNAL ACS Synth Biol 10 (7), 1739-1749 (2021) PUBMED 34197093 REFERENCE 2 (bases 1 to 7997) AUTHORS Lau MSH., Sheng L, Zhang Y, Minton NP. TITLE Direct Submission JOURNAL Submitted (10-MAY-2021) Biodiscovery Institute, School of Life Sciences, University of Nottingham, Science Road, University Park, Nottingham, Nottinghamshire NG7 2RD, United Kingdom REFERENCE 3 (bases 1 to 7997) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "ACS Synth Biol"; date: "2021"; volume: "10"; issue: "7"; pages: "1739-1749" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (10-MAY-2021) Biodiscovery Institute, School of Life Sciences, University of Nottingham, Science Road, University Park, Nottingham, Nottinghamshire NG7 2RD, United Kingdom" FEATURES Location/Qualifiers source 1..7997 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(12..4175) /gene="cas9-2" /label="CRISPR-associated endonuclease Cas9 2" /note="CRISPR-associated endonuclease Cas9 2 from Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9). Accession#: Q03JI6" regulatory complement(4176..4360) /label="lactate dehydrogenase promoter and RBS" /note="lactate dehydrogenase promoter and RBS" /regulatory_class="promoter" regulatory 4367..4457 /label="glyceraldehyde 3-phosphate dehydrogenase promoter" /note="glyceraldehyde 3-phosphate dehydrogenase promoter" /regulatory_class="promoter" terminator 4595..4681 /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" terminator 4773..4800 /label="rrnB T2 terminator" /note="transcription terminator T2 from the E. coli rrnB gene" primer_bind complement(4810..4826) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" CDS 5262..6263 /label="repB" /note="RepB replication protein" CDS 6420..7190 /codon_start=1 /transl_table=11 /product="kanamycin nucleotidyltransferase" /label="kanamycin nucleotidyltransferase" /protein_id="QXV87314.1" /translation="MRIVNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGR QTDGPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFYSEEILLDYASQVESDWPLTHG QFFSILPIYDSGGYLEKVYQTAKSVEAQKFHDAICALIVEELFEYAGKWRNIRVQGPTT FLPSLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSD SEKLLESLENFWNGIQEWTERHGYIVDVSKRIPF" rep_origin 7198..7781 /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.