pCloDF13-URRrthc vector (V016396)

Download GeneBank File(.gb)

LOCUS       V016396                 9726 bp    DNA     circular SYN 16-MAY-2020
DEFINITION  Exported.
ACCESSION   V016396
VERSION     V016396
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 9726)
  AUTHORS   Guo L.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2019) Jiangnan University, State Key Laboratory of
            Food Science and Technology, 1800 Lihu Avenue, Wuxi, Jiangsu 214122,
            China
REFERENCE   2  (bases 1 to 9726)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Submitted
            (28-OCT-2019) Jiangnan University, State Key Laboratory of Food
            Science and Technology, 1800 Lihu Avenue, Wuxi, Jiangsu 214122,
            China"
FEATURES             Location/Qualifiers
     source          1..9726
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             119..907
                     /label="SmR"
                     /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
     rep_origin      1161..1899
                     /label="CloDF13 ori"
                     /note="Plasmids containing the CloDF13 (CDF) origin of
                     replication can be propagated in E. coli cells that contain
                     additional plasmids with compatible origins."
     promoter        1953..1987
                     /label="J23119 promoter"
                     /note="bacterial promoter (Registry of Standard Biological
                     Parts BBa_J23119)"
     CDS             2137..2856
                     /gene="ubiG"
                     /label="Ubiquinone biosynthesis O-methyltransferase"
                     /note="Ubiquinone biosynthesis O-methyltransferase from
                     Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 /
                     NCIMB 8545 / WDCM 00012 / Crooks). Accession#: B1IXV6"
     CDS             2883..3893
                     /gene="rssB"
                     /label="Regulator of RpoS"
                     /note="Regulator of RpoS from Escherichia coli (strain
                     K12). Accession#: P0AEV1"
     CDS             3897..3914
                     /label="6xHis"
                     /note="6xHis affinity tag"
     terminator      3981..4028
                     /label="T7 terminator"
                     /note="transcription terminator for bacteriophage T7 RNA
                     polymerase"
     protein_bind    complement(4064..4097)
                     /label="loxP"
                     /note="Cre-mediated recombination occurs in the 8-bp core
                     sequence (ATGTATGC) (Shaw et al., 2021)."
     CDS             4124..5134
                     /gene="rssB"
                     /label="Regulator of RpoS"
                     /note="Regulator of RpoS from Escherichia coli (strain
                     K12). Accession#: P0AEV1"
     CDS             5138..5155
                     /label="6xHis"
                     /note="6xHis affinity tag"
     regulatory      5222..5269
                     /label="T7 terminator"
                     /note="T7 terminator"
                     /regulatory_class="terminator"
     CDS             5436..6425
                     /gene="rpoS"
                     /label="RNA polymerase sigma factor RpoS"
                     /note="RNA polymerase sigma factor RpoS from Escherichia
                     coli (strain K12). Accession#: P13445"
     CDS             6435..6452
                     /label="6xHis"
                     /note="6xHis affinity tag"
     regulatory      6519..6566
                     /label="T7 terminator"
                     /note="T7 terminator"
                     /regulatory_class="terminator"
     protein_bind    complement(6598..6631)
                     /label="lox2272"
                     /note="Cre-mediated recombination occurs in the 8-bp core
                     sequence (AAGTATCC) (Shaw et al., 2021). lox2272 sites are
                     compatible with each other, but incompatible with loxP or
                     loxN sites (Lee and Saito, 1988)."
     CDS             6658..7851
                     /gene="fabV"
                     /label="Trans-2-enoyl-CoA reductase [NADH]"
                     /note="Trans-2-enoyl-CoA reductase [NADH] from Clostridium
                     acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG
                     5710 / VKM B-1787). Accession#: Q97LU2"
     gene            7879..8727
                     /gene="hbd"
                     /label="hbd"
     CDS             7879..8727
                     /codon_start=1
                     /transl_table=11
                     /gene="hbd"
                     /product="3-hydroxybutyryl-CoA dehydrogenase"
                     /label="hbd"
                     /protein_id="QJR97829.1"
                     /translation="MKKVCVIGAGTMGSGIAQAFAAKGFEVVLRDIKDEFVDRGLDFIN
                     KNLSKLVKKGKIEEATKVEILTRISGTVDLNMAADCDLVIEAAVERMDIKKQIFADLDN
                     ICKPETILASNTSSLSITEVASATKTNDKVIGMHFFNPAPVMKLVEVIRGIATSQETFD
                     AVKETSIAIGKDPVEVAEAPGFVVNRILIPMINEAVGILAEGIASVEDIDKAMKLGANH
                     PMGPLELGDFIGLDICLAIMDVLYSETGDSKYRPHTLLKKYVRAGWLGRKSGKGFYDYS
                     K"
     CDS             8755..9537
                     /gene="crt"
                     /label="Short-chain-enoyl-CoA hydratase"
                     /note="Short-chain-enoyl-CoA hydratase from Clostridium
                     acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG
                     5710 / VKM B-1787). Accession#: P52046"
     CDS             9547..9564
                     /label="6xHis"
                     /note="6xHis affinity tag"
     regulatory      9632..9678
                     /label="T7 terminator"
                     /note="T7 terminator"
                     /regulatory_class="terminator"