Basic Vector Information
- Vector Name:
- pCloDF13-URRrthc
- Antibiotic Resistance:
- Streptomycin
- Length:
- 9726 bp
- Type:
- Cloning vector
- Replication origin:
- CloDF13 ori
- Source/Author:
- Guo L.
- Promoter:
- J23119
pCloDF13-URRrthc vector Vector Map
pCloDF13-URRrthc vector Sequence
LOCUS V016396 9726 bp DNA circular SYN 16-MAY-2020 DEFINITION Exported. ACCESSION V016396 VERSION V016396 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9726) AUTHORS Guo L. TITLE Direct Submission JOURNAL Submitted (28-OCT-2019) Jiangnan University, State Key Laboratory of Food Science and Technology, 1800 Lihu Avenue, Wuxi, Jiangsu 214122, China REFERENCE 2 (bases 1 to 9726) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (28-OCT-2019) Jiangnan University, State Key Laboratory of Food Science and Technology, 1800 Lihu Avenue, Wuxi, Jiangsu 214122, China" FEATURES Location/Qualifiers source 1..9726 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 119..907 /label="SmR" /note="aminoglycoside adenylyltransferase (Murphy, 1985)" rep_origin 1161..1899 /label="CloDF13 ori" /note="Plasmids containing the CloDF13 (CDF) origin of replication can be propagated in E. coli cells that contain additional plasmids with compatible origins." promoter 1953..1987 /label="J23119 promoter" /note="bacterial promoter (Registry of Standard Biological Parts BBa_J23119)" CDS 2137..2856 /gene="ubiG" /label="Ubiquinone biosynthesis O-methyltransferase" /note="Ubiquinone biosynthesis O-methyltransferase from Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks). Accession#: B1IXV6" CDS 2883..3893 /gene="rssB" /label="Regulator of RpoS" /note="Regulator of RpoS from Escherichia coli (strain K12). Accession#: P0AEV1" CDS 3897..3914 /label="6xHis" /note="6xHis affinity tag" terminator 3981..4028 /label="T7 terminator" /note="transcription terminator for bacteriophage T7 RNA polymerase" protein_bind complement(4064..4097) /label="loxP" /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." CDS 4124..5134 /gene="rssB" /label="Regulator of RpoS" /note="Regulator of RpoS from Escherichia coli (strain K12). Accession#: P0AEV1" CDS 5138..5155 /label="6xHis" /note="6xHis affinity tag" regulatory 5222..5269 /label="T7 terminator" /note="T7 terminator" /regulatory_class="terminator" CDS 5436..6425 /gene="rpoS" /label="RNA polymerase sigma factor RpoS" /note="RNA polymerase sigma factor RpoS from Escherichia coli (strain K12). Accession#: P13445" CDS 6435..6452 /label="6xHis" /note="6xHis affinity tag" regulatory 6519..6566 /label="T7 terminator" /note="T7 terminator" /regulatory_class="terminator" protein_bind complement(6598..6631) /label="lox2272" /note="Cre-mediated recombination occurs in the 8-bp core sequence (AAGTATCC) (Shaw et al., 2021). lox2272 sites are compatible with each other, but incompatible with loxP or loxN sites (Lee and Saito, 1988)." CDS 6658..7851 /gene="fabV" /label="Trans-2-enoyl-CoA reductase [NADH]" /note="Trans-2-enoyl-CoA reductase [NADH] from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787). Accession#: Q97LU2" gene 7879..8727 /gene="hbd" /label="hbd" CDS 7879..8727 /codon_start=1 /transl_table=11 /gene="hbd" /product="3-hydroxybutyryl-CoA dehydrogenase" /label="hbd" /protein_id="QJR97829.1" /translation="MKKVCVIGAGTMGSGIAQAFAAKGFEVVLRDIKDEFVDRGLDFIN KNLSKLVKKGKIEEATKVEILTRISGTVDLNMAADCDLVIEAAVERMDIKKQIFADLDN ICKPETILASNTSSLSITEVASATKTNDKVIGMHFFNPAPVMKLVEVIRGIATSQETFD AVKETSIAIGKDPVEVAEAPGFVVNRILIPMINEAVGILAEGIASVEDIDKAMKLGANH PMGPLELGDFIGLDICLAIMDVLYSETGDSKYRPHTLLKKYVRAGWLGRKSGKGFYDYS K" CDS 8755..9537 /gene="crt" /label="Short-chain-enoyl-CoA hydratase" /note="Short-chain-enoyl-CoA hydratase from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787). Accession#: P52046" CDS 9547..9564 /label="6xHis" /note="6xHis affinity tag" regulatory 9632..9678 /label="T7 terminator" /note="T7 terminator" /regulatory_class="terminator"
This page is informational only.