Basic Vector Information
- Vector Name:
- pTS9
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5191 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Schnabel T.
pTS9 vector Map
pTS9 vector Sequence
LOCUS 62056_21595 5191 bp DNA circular SYN 09-MAY-2021 DEFINITION Cloning vector pTS9, complete sequence. ACCESSION MW835298 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5191) AUTHORS Schnabel T. TITLE Engineering post-translational regulation of glutamine synthetase for controllable ammonia production in the plant-symbiont A. brasilense JOURNAL Unpublished REFERENCE 2 (bases 1 to 5191) AUTHORS Schnabel T. TITLE Direct Submission JOURNAL Submitted (30-MAR-2021) Bioengineering, Stanford University, 443 Via Ortega, Stanford, CA 94305, USA REFERENCE 3 (bases 1 to 5191) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (30-MAR-2021) Bioengineering, Stanford University, 443 Via Ortega, Stanford, CA 94305, USA" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5191 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 139..727 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" regulatory 778..812 /label=pJ23101 /note="pJ23101" /regulatory_class="promoter" regulatory 828..842 /label=B0030 /note="B0030" /regulatory_class="ribosome_binding_site" gene 849..1868 /gene="pheS*" /label=pheS* CDS 849..1868 /codon_start=1 /transl_table=11 /gene="pheS*" /product="phenylalanine--tRNA ligase alpha subunit" /function="toxic in presence of 4-chlorophenylalanine" /label=pheS* /protein_id="QUQ60671.1" /translation="MLDALKDELLSQVNAAGDLAALEEVRVTALGKKGRITGFMKELGG LSPDERRERGQQLNALKDEIAAAIDGRKADLARAHLEARLQAERIDVTLPVRPETEGRI HPISQTIDEMVAIFAEMGFSVAEGPDVEDDFHNFTALNFPPGHPARDMHDTFYLPDAGD KKMLLRTHTSPVQVRTMLNKKPPIRIIAPGRTYRSDYDMTHTPMFHQIEGLVIDEATHM GHLKGCLIEFCRAFFDVDDLPLRFRPSFFPFAEPSAEVDIGCSRKGGELKLGNYGDWLE ILGCGMVHPNVLEACGIDSTKYQGFGFGMGIERVAMLKYGIPDLRTFFEADLRWLKHY" regulatory 1885..1997 /label=pKan /note="pKan" /regulatory_class="promoter" oriT complement(1885..1936) /direction=LEFT /note="oriT" CDS 2004..2795 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" misc_feature 2830..2873 /label=multiple cloning site /note="multiple cloning site" CDS 2905..2916 /label=Factor Xa site /note="Factor Xa recognition and cleavage site" misc_feature 3299..3309 /label=threeway stop /note="threeway stop" misc_feature 3316..3362 /note="insert spacer for knock-out or circuit of interest for knock-in" misc_feature 3369..3379 /label=threeway stop /note="threeway stop" misc_feature 3380..3800 /note="downstream overlap to chromosome (here an example fragment of A. brasilense Sp245)" misc_feature 3801..3821 /label=multiple cloning site /note="multiple cloning site" oriT complement(3913..4022) /direction=LEFT /label=oriT /note="incP origin of transfer" promoter 4194..4298 /label=AmpR promoter CDS 4299..5156 /label=AmpR /note="beta-lactamase"
This page is informational only.