Basic Vector Information
- Vector Name:
- pLBT1
- Antibiotic Resistance:
- Apramycin
- Length:
- 7915 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Li L.
pLBT1 vector Vector Map
pLBT1 vector Sequence
LOCUS 62056_13725 7915 bp DNA circular SYN 13-MAY-2019 DEFINITION Cloning vector pLBT1, complete sequence. ACCESSION MK176918 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7915) AUTHORS Li L. TITLE Direct Submission JOURNAL Submitted (13-NOV-2018) Key Laboratory of Synthetic Biology, Institute of Plant Physiology and Ecology, 300 Feng Lin Road, Shanghai, Shanghai 200032, China REFERENCE 2 (bases 1 to 7915) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (13-NOV-2018) Key Laboratory of Synthetic Biology, Institute of Plant Physiology and Ecology, 300 Feng Lin Road, Shanghai, Shanghai 200032, China" FEATURES Location/Qualifiers source 1..7915 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 1215..1226 /label=WELQut site /note="WELQut protease recognition and cleavage site" primer_bind 2593..2609 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" regulatory complement(2659..2755) /regulatory_class="promoter" primer_bind complement(2776..2792) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2800..2816) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2824..2854) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2869..2890) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(3178..3766) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 4019..4819 /label=ApmR /note="aminoglycoside 3-N-acetyltransferase type IV" CDS complement(5256..5624) /label=traJ /note="oriT-recognizing protein" oriT complement(5657..5766) /direction=LEFT /label=oriT /note="incP origin of transfer" CDS 6059..7843 /codon_start=1 /transl_table=11 /product="phiBT1 integrase" /label=phiBT1 integrase /protein_id="QCO69765.1" /translation="MSPFIAPDVPEHLLDTVRVFLYARQSKGRSDGSDVSTEAQLAAGR ALVASRNAQGGARWVVAGEFVDVGRSGWDPNVTRADFERMMGEVRAGEGDVVVVNELSR LTRKGAHDALEIDNELKKHGVRFMSVLEPFLDTSTPIGVAIFALIAALAKQDSDLKAER LKGAKDEIAALGGVHSSSAPFGMRAVRKKVDNLVISVLEPDEDNPDHVELVERMAKMSF EGVSDNAIATTFEKEKIPSPGMAERRATEKRLASIKARRLNGAEKPIMWRAQTVRWILN HPAIGGFAFERVKHGKAHINVIRRDPGGKPLTPHTGILSGSKWLELQEKRSGKNLSDRK PGAEVEPTLLSGWRFLGCRICGGSMGQSQGGRKRNGDLAEGNYMCANPKGHGGLSVKRS ELDEFVASKVWARLRTADMEDEHDQAWIAAAAERFALQHDLAGVADERREQQAHLDNVR RSIKDLQADRKAGLYVGREELETWRSTVLQYRSYEAECTTRLAELDEKMNGSTRVPSEW FSGEDPTAEGGIWASWDVYERREFLSFFLDSVMVDRGRHPETKKYIPLKDRVTLKWAEL LKEEDEASEATERELAAL"
This page is informational only.