Basic Vector Information
- Vector Name:
- FA(2)_YQR
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3852 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Groseclose TM, Rondon RE, Herde ZD, Aldrete CA
FA(2)_YQR vector Vector Map
FA(2)_YQR vector Sequence
LOCUS 62056_776 3852 bp DNA circular SYN 10-SEP-2020 DEFINITION Cloning vector FA(2)_YQR, complete sequence. ACCESSION MT127357 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3852) AUTHORS Groseclose TM, Rondon RE, Herde ZD, Aldrete CA, Wilson CJ. TITLE Engineered systems of inducible anti-repressors for the next generation of biological programming JOURNAL Nat Commun 11 (1), 4440 (2020) PUBMED 32895374 REFERENCE 2 (bases 1 to 3852) AUTHORS Groseclose TM, Rondon RE, Herde ZD, Aldrete CA, Wilson CJ. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 3852) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun"; date: "2020"; volume: "11"; issue: "1"; pages: "4440" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (28-FEB-2020) Chemical " COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..3852 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 596..673 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 674..1678 /codon_start=1 /transl_table=11 /product="FA(2)_YQR" /label=FA /protein_id="QLY89231.1" /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKSSRSIGLVIPDLENTSYSRFANYLERQARQRGYQLIIACSEDQPD IEMRCIEHLFQRQVDANIVSTSLPPEHPFYQRWANDPFPIVALDRALDRVHFTSVVGAD QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVHFLYANSYER EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGNQPSDLAIATFGDNELLDF LQCPVLAVAQRHRVVAERVLEIVLASLDEPRKPKPGLTRIKRILYRRGVLSRS" protein_bind 1808..1829 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin 2020..2564 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." promoter 3090..3192 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 3193..3849 /label=CmR /note="chloramphenicol acetyltransferase"
This page is informational only.