Basic Vector Information
- Vector Name:
- pMMZ284
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6172 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Mansouri M, Hussherr M-D., Strittmatter T, Buchmann P
- Promoter:
- SV40
pMMZ284 vector Map
pMMZ284 vector Sequence
LOCUS 62056_17185 6172 bp DNA circular SYN 21-APR-2021
DEFINITION Cloning vector pMMZ284, complete sequence.
ACCESSION MW731449
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6172)
AUTHORS Mansouri M, Hussherr M-D., Strittmatter T, Buchmann P, Xue S,
Camenisch G, Fussenegger M.
TITLE Smart-Watch-Programmed Green-Light-Operated Percutaneous Control of
Therapeutic Transgenes
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 6172)
AUTHORS Mansouri M, Hussherr M-D., Strittmatter T, Buchmann P, Xue S,
Camenisch G, Fussenegger M.
TITLE Direct Submission
JOURNAL Submitted (12-MAR-2021) DBSSE, ETH, Mattenstrasse 26, Basel, Choose
A State 4058, Switzerland
REFERENCE 3 (bases 1 to 6172)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(12-MAR-2021) DBSSE, ETH, Mattenstrasse 26, Basel, Choose A State
4058, Switzerland"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..6172
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind complement(49..65)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(73..89)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(97..127)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(142..163)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(451..1036)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(1210..2067)
/label=AmpR
/note="beta-lactamase"
promoter complement(2068..2172)
/label=AmpR promoter
promoter 2494..2512
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
CDS 2544..3938
/codon_start=1
/transl_table=11
/product="Myr-TtCBD-nGFP"
/label=Myr-TtCBD-nGFP
/note="Supercharged membrane anchored TtCBD"
/protein_id="QTW97888.1"
/translation="MGCINSKRKDASPEDLGTGLLEALLRGDLAGAEALFRRGLRFWGP
EGILEHLLLPVLREVGEAWHRGEIGVAEEHLASTFLRARLQELLDLAGFPPGPPVLVTT
PPGERHEIGAMLAAYHLRRKGVPALYLGPDTPLPDLRALARRLGAGAVVLSALLSEPLR
ALPDGALKDLAPRVFLGGQGAGPEEARRLGAEYMEDLKGLAEALWLPRGPEKEAIASKG
EELFDGVVPILVELDGDVNGHEFSVRGEGEGDATEGELTLKFICTTGELPVPWPTLVTT
LTYGVQCFSDYPDHMDQHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNR
IELKGIDFKEDGNILGHKLEYNFNSHDVYITADKQENGIKAEFEIRHNVEDGSVQLADH
YQQNTPIGDGPVLLPDDHYLSTESALSKDPNEDRDHMVLLEFVTAAGIDHGMDELYKTA
SGSTGV"
polyA_signal 3975..4199
/label=bGH poly(A) signal
/note="bovine growth hormone polyadenylation signal"
rep_origin 4245..4673
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 4687..5016
/label=SV40 promoter
/note="SV40 enhancer and early promoter"
CDS 5083..5874
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
polyA_signal 6051..6172
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
This page is informational only.