Basic Vector Information
- Vector Name:
- pNRVL-caSAT1-GFP
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7111 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Nemeth T.
pNRVL-caSAT1-GFP vector Map
pNRVL-caSAT1-GFP vector Sequence
LOCUS 62056_18215 7111 bp DNA circular SYN 03-MAR-2020 DEFINITION Expression vector pNRVL-caSAT1-GFP, complete sequence. ACCESSION MT001912 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7111) AUTHORS Nemeth T. TITLE Direct Submission JOURNAL Submitted (28-JAN-2020) Department of Microbiology, University of Szeged, Kozep fasor 52, Szeged, Csongrad 6726, Hungary REFERENCE 2 (bases 1 to 7111) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (28-JAN-2020) Department of Microbiology, University of Szeged, Kozep fasor 52, Szeged, Csongrad 6726, Hungary" COMMENT ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench v. v11 Sequencing Technology :: IonTorrent ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..7111 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(268..295) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(387..473) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 537..553 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 570..575 /label=StuI site for cassette release /note="StuI site for cassette release" misc_feature 576..1039 /note="site of recombination; CpNEUT5LUpup from C. parapsilosis" regulatory 1094..1591 /label=Candida albicans ACT1 promoter /note="Candida albicans ACT1 promoter" /regulatory_class="promoter" gene 1592..2818 /gene="caSAT1" /label=caSAT1 CDS join(1592..1601,2256..2818) /codon_start=1 /transl_table=11 /gene="caSAT1" /product="streptothricin acetyltransferase" /label=caSAT1 /note="codon-optimized for Candida albicans" /protein_id="QID92297.1" /translation="MDGEEVAALVIDNGSHMKISVIPEQVAETLDAENHFIVREVFDVH LSDQGFELSTRSVSPYRKDYISDDDSDEDSACYGAFIDQELVGKIELNSTWNDLASIEH IVVSHTHRGKGVAHSLIEFAKKWALSRQLLGIRLETQTNNVPACNLYAKCGFTLGGIDL FTYKTRPQVSNETAMYWYWFSGAQDDA" regulatory 2822..2951 /label=Candida albicans URA3 terminator /note="Candida albicans URA3 terminator" /regulatory_class="terminator" regulatory complement(2999..3239) /label=Saccharomyces cerevisiae URA3 terminator /note="Saccharomyces cerevisiae URA3 terminator" /regulatory_class="terminator" protein_bind 3260..3284 /label=attB2 /note="recombination site for the Gateway(R) BP reaction" CDS complement(3288..4001) /label=yeGFP /note="yeast-enhanced green fluorescent protein" protein_bind complement(4002..4026) /label=attB1 /note="recombination site for the Gateway(R) BP reaction" regulatory complement(4033..4882) /label=Candida albicans TDH3 promoter /note="Candida albicans TDH3 promoter" /regulatory_class="promoter" misc_feature 4889..5339 /note="site of recombination; CpNEUT5LDowndown from C. parapsilosis" misc_feature 5340..5345 /label=StuI site for cassette release /note="StuI site for cassette release" promoter complement(5353..5371) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(5376..5392) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 5505..6311 /label=KanR /note="aminoglycoside phosphotransferase" rep_origin 6461..7049 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.