Basic Vector Information
- Vector Name:
- pLG327
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8386 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Gonzalez LM, Mukhitov N, Voigt CA.
pLG327 vector Map
pLG327 vector Sequence
LOCUS 62056_14080 8386 bp DNA circular SYN 16-DEC-2019 DEFINITION Cloning vector pLG327, complete sequence. ACCESSION MN443781 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8386) AUTHORS Gonzalez LM, Mukhitov N, Voigt CA. TITLE Resilient living materials built by printing bacterial spores JOURNAL Nat. Chem. Biol. (2019) In press PUBMED 31792444 REFERENCE 2 (bases 1 to 8386) AUTHORS Mukhitov N, Gonzalez LM, Voigt CA. TITLE Direct Submission JOURNAL Submitted (11-SEP-2019) Biological Engineering, MIT, NE47-140, 500 Tech Square, Cambridge, MA 02139, USA REFERENCE 3 (bases 1 to 8386) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Chem. Biol. (2019) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-SEP-2019) Biological Engineering, MIT, NE47-140, 500 Tech Square, Cambridge, MA 02139, USA" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..8386 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 106..210 /label=AmpR promoter CDS 211..1068 /label=AmpR /note="beta-lactamase" rep_origin 1242..1830 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 2963..4139 /label=similar to AmyE /note="similar to AmyE" gene complement(4264..5046) /gene="specR" /label=specR CDS complement(5344..6528) /codon_start=1 /transl_table=11 /product="XylR" /label=XylR /protein_id="QGV56735.1" /translation="MTGLNKSTVSSQVNTLMKENLVFEIGQGQSSGGRRPVMLVFNKKA GYSIGIDVGVDYISGILTDLEGTIILDQQSGGRRPVMLVFNKKAGYSIGIDVGVDYISG ILTDLEGTIILDQHHHLESNSPEITKDILIDMIHHFITRMPQSPYGLIGIGICVPGLID KNQKIVFTPNSNWRDIDLKSFIQEKFNVPVFIENEANAGAYGEKVFGAAKNHNNIIYAS ISTGIGIGVIINNHLYRGVSGFSGEMGHMTIDFNGPKCSCGNRGCWELYASEKALLKSL QTKEKKVSYQDIIDLAHLNDIGTLNALQNFGFYLGIGLTNILNTFNPQAIILRNSIIES HPMVLNSIRSEVSSRVYPQLGNSYELLPSSLGKNAPALGMSSIVIEHFLDIVKM" terminator 6642..6713 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" regulatory 6734..6762 /label=Pxyl /note="Pxyl" /regulatory_class="promoter" misc_binding 6771..6797 /label=XylO binding site /bound_moiety="XylO" misc_RNA 6799..6849 /label=sTRSV HHRz /note="hammerhead ribozyme from the tobacco ringspot virus satellite RNA (Khvorova et al., 2003)" regulatory 6880..6891 /label=SpoVG /note="SpoVG" /regulatory_class="ribosome_binding_site" CDS 6900..7607 /label=yeGFP /note="yeast-enhanced green fluorescent protein" terminator 7642..7689 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" misc_feature 7719..8386 /label=similar to AmyE /note="similar to AmyE"
This page is informational only.