Basic Vector Information
- Vector Name:
- pGEX_LacI_TetR_chPylRS_IPYE
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5990 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Fischer EC, Hashimoto K, Zhang Y, Feldman AW
pGEX_LacI_TetR_chPylRS_IPYE vector Map
pGEX_LacI_TetR_chPylRS_IPYE vector Sequence
LOCUS 62056_11515 5990 bp DNA circular SYN 19-APR-2020 DEFINITION Cloning vector pGEX_LacI_TetR_chPylRS_IPYE, complete sequence. ACCESSION MN882189 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5990) AUTHORS Fischer EC, Hashimoto K, Zhang Y, Feldman AW, Dien VT, Karadeema RJ, Adhikary R, Ledbetter MP, Krishnamurthy R, Romesberg FE. TITLE New codons for efficient production of unnatural proteins in a semi-synthetic organism JOURNAL Nat. Chem. Biol. (2020) In press REFERENCE 2 (bases 1 to 5990) AUTHORS Fischer EC. TITLE Direct Submission JOURNAL Submitted (27-DEC-2019) Department of Chemistry, The Scripps Research Institute, 10550 North Torrey Pines Road, La Jolla, CA 92037, USA REFERENCE 3 (bases 1 to 5990) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Chem. Biol. (2020) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-DEC-2019) Department of Chemistry, The Scripps Research Institute, 10550 North Torrey Pines Road, La Jolla, CA 92037, USA" FEATURES Location/Qualifiers source 1..5990 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 19..607 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" regulatory 717..786 /label=AmpR promoter /note="AmpR promoter" /regulatory_class="promoter" CDS 846..1466 /label=TetR /note="tetracycline repressor TetR" terminator complement(1491..1577) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" promoter 1893..1970 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 1971..3050 /label=lacI /note="lac repressor" promoter 3171..3199 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 3207..3223 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 3246..4505 /codon_start=1 /transl_table=11 /product="chimeric PylRS variant" /label=chimeric PylRS variant /note="chimeric PylRS variant; Methanosarcina mazei/barkeri chPylRS(IPYE)" /protein_id="QIZ64217.1" /translation="MDKKPLDVLISATGLWMSRTGTLHKIKHYEISRSKIYIEMACGDH LVVNNSRSCRPARAFRYHKYRKTCKRCRVSDEDINNFLTRSTEGKTSVKVKVVSEPKVK KAMPKSVSRAPKPLENPVSAKASTDTSRSVPSPAKSTPNSPVPTSASAPALTKSQTDRL EVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDR GFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRAL PDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFK IVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDF KNIKRAARSESYYNGISTNL" terminator 4729..4776 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" promoter 4873..4977 /label=AmpR promoter CDS 4978..5835 /label=AmpR /note="beta-lactamase"
This page is informational only.