pSKA538 vector (V016342)

Download GeneBank File(.gb)

LOCUS       V016342                 6903 bp    DNA     circular SYN 26-JUN-2019
DEFINITION  Exported.
ACCESSION   V016342
VERSION     V016342
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 6903)
  AUTHORS   Aoki SK, Lillacci G, Gupta A, Baumschlager A, Schweingruber D,
            Khammash M.
  TITLE     A universal biomolecular integral feedback controller for robust
            perfect adaptation
  JOURNAL   Nature 570, 533-537 (2019)
   PUBMED   31217585
REFERENCE   2  (bases 1 to 6903)
  AUTHORS   Aoki SK, Lillacci G.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) Biosystems Science and Engineering, ETH
            Zurich, Mattenstrasse 26, Basel 4058, Switzerland
REFERENCE   3  (bases 1 to 6903)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nature 570,
            533-537 (2019)"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (09-APR-2019) Biosystems Science and Engineering, ETH Zurich,
            Mattenstrasse 26, Basel 4058, Switzerland"
FEATURES             Location/Qualifiers
     source          1..6903
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      26..47
                     /label="UP element"
                     /note="UP element"
                     /regulatory_class="enhancer"
     regulatory      50..85
                     /label="PsigW"
                     /note="PsigW"
                     /regulatory_class="promoter"
     regulatory      112..118
                     /label="sRBS"
                     /note="sRBS"
                     /regulatory_class="ribosome_binding_site"
     CDS             128..169
                     /label="V5 tag"
                     /note="epitope tag from simian virus 5"
     CDS             176..1048
                     /label="araC"
                     /note="L-arabinose regulatory protein"
     regulatory      1139..1145
                     /label="sRBS"
                     /note="sRBS"
                     /regulatory_class="ribosome_binding_site"
     CDS             1155..1178
                     /label="FLAG"
                     /note="FLAG(R) epitope tag, followed by an enterokinase
                     cleavage site"
     CDS             1191..1901
                     /label="superfolder GFP"
                     /note="GFP variant that folds robustly even when fused to
                     poorly folded proteins (Pedelacq et al., 2006)"
     terminator      2206..2292
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      2384..2411
                     /label="rrnB T2 terminator"
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     terminator      complement(2462..2509)
                     /label="T7 terminator"
                     /note="transcription terminator for bacteriophage T7 RNA
                     polymerase"
     CDS             complement(2513..3262)
                     /gene="luxR"
                     /label="Transcriptional activator protein LuxR"
                     /note="Transcriptional activator protein LuxR from
                     Aliivibrio fischeri. Accession#: P12746"
     regulatory      complement(3291..3344)
                     /label="Pconstitutive"
                     /note="Pconstitutive"
                     /regulatory_class="promoter"
     regulatory      3395..3459
                     /label="Plux"
                     /note="Plux"
                     /regulatory_class="promoter"
     regulatory      3395..3414
                     /label="LuxR binding site"
                     /note="LuxR binding site"
                     /regulatory_class="other"
     regulatory      3460..3485
                     /label="RBS5000"
                     /note="RBS5000"
                     /regulatory_class="ribosome_binding_site"
     CDS             3486..4046
                     /gene="sigW"
                     /label="ECF RNA polymerase sigma factor SigW"
                     /note="ECF RNA polymerase sigma factor SigW from Bacillus
                     subtilis (strain 168). Accession#: Q45585"
     regulatory      4061..4147
                     /label="rrnB T1 terminator"
                     /note="rrnB T1 terminator"
                     /regulatory_class="terminator"
     regulatory      4174..4245
                     /label="PBAD"
                     /note="PBAD"
                     /regulatory_class="promoter"
     regulatory      4174..4190
                     /label="AraC I1 binding site"
                     /note="AraC I1 binding site"
                     /regulatory_class="other"
     regulatory      4195..4211
                     /label="AraC I2 binding site"
                     /note="AraC I2 binding site"
                     /regulatory_class="other"
     regulatory      4261..4286
                     /label="RBS5000"
                     /note="RBS5000"
                     /regulatory_class="ribosome_binding_site"
     CDS             4287..4550
                     /codon_start=1
                     /transl_table=11
                     /product="RsiW"
                     /label="RsiW"
                     /note="cytoplasmic RsiW domain"
                     /protein_id="QDD67909.1"
                     /translation="MSCPEQIVQLMHMHLDGDILPKDEHVLNEHLETCEKCRKHFYEME
                     KSIALVRSTSHVEAPADFTANVMAKLPKEKKRASVKRWFRTH"
     terminator      complement(4768..4811)
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     rep_origin      complement(5074..5662)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     terminator      complement(5750..5844)
                     /label="lambda t0 terminator"
                     /note="transcription terminator from phage lambda"
     CDS             complement(5877..6734)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(6735..6839)
                     /label="AmpR promoter"