Basic Vector Information
- Vector Name:
- pJY12
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8716 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Yayo J, Kuil T, Olson DG, Lynd LR
pJY12 vector Map
pJY12 vector Sequence
LOCUS V016341 8716 bp DNA circular SYN 16-FEB-2021 DEFINITION Exported. ACCESSION V016341 VERSION V016341 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8716) AUTHORS Yayo J, Kuil T, Olson DG, Lynd LR, Holwerda EK, van Maris AJA. TITLE Laboratory evolution and reverse engineering of Clostridium thermocellum for growth on glucose and fructose JOURNAL Unpublished REFERENCE 2 (bases 1 to 8716) AUTHORS Yayo J, Kuil T, Olson DG, Lynd LR, Holwerda EK, van Maris AJA. TITLE Direct Submission JOURNAL Submitted (09-DEC-2020) Industrial Biotechnology, KTH Royal Institute of Technology, Roslagstullsbacken 21, Stockholm 11421, Sweden REFERENCE 3 (bases 1 to 8716) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (09-DEC-2020) Industrial Biotechnology, KTH Royal Institute of Technology, Roslagstullsbacken 21, Stockholm 11421, Sweden" FEATURES Location/Qualifiers source 1..8716 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 1..455 /label="C. thermocellum origin of replication" /note="C. thermocellum origin of replication" CDS 456..1457 /label="repB" /note="RepB replication protein" regulatory 1536..2156 /label="C. thermocellum cbp promoter" /note="C. thermocellum cbp promoter" /regulatory_class="promoter" gene 2157..2735 /gene="tdk" /label="tdk" CDS 2157..2735 /codon_start=1 /transl_table=11 /gene="tdk" /product="thymidine kinase" /label="tdk" /protein_id="QRQ89509.1" /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP ANYDDPIIMVGAKESYEARCRKCHEVPRT" rep_origin complement(3002..3547) /direction=LEFT /label="p15A ori" /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." terminator complement(3597..3785) /label="CYC1 terminator" /note="transcription terminator for CYC1" misc_feature complement(3821..4369) /label="gene target internal homology recombination flank" /note="gene target internal homology recombination flank" gene complement(4554..5099) /gene="hpt" /label="hpt" CDS complement(4554..5099) /codon_start=1 /transl_table=11 /gene="hpt" /product="hypoxanthine phosphoribosyltransferase" /label="hpt" /protein_id="QRQ89510.1" /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD EKYRNLPFIGVLKPEMYS" CDS complement(5120..5767) /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" regulatory complement(5768..6342) /label="C. thermocellum gapDH promoter" /note="C. thermocellum gapDH promoter" /regulatory_class="promoter" misc_feature complement(6346..6967) /label="downstream homology recombination 3' flank" /note="downstream homology recombination 3' flank" misc_feature complement(6968..7556) /label="upstream homology recombination 5' flank" /note="upstream homology recombination 5' flank" promoter 7649..7753 /label="AmpR promoter" CDS 7754..8611 /label="AmpR" /note="beta-lactamase"
This page is informational only.