Basic Vector Information
- Vector Name:
- pLM459-mTurquoise2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4680 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Emrich-Mills TZ, Yates G, Barrett J, Grouneva I
pLM459-mTurquoise2 vector Vector Map
pLM459-mTurquoise2 vector Sequence
LOCUS 62056_14350 4680 bp DNA circular SYN 28-MAR-2021 DEFINITION Cloning vector pLM459-mTurquoise2, complete sequence. ACCESSION MT737964 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4680) AUTHORS Emrich-Mills TZ, Yates G, Barrett J, Grouneva I, Lau CS, Walker CE, Kwok TK, Davey JW, Johnson MP, Mackinder LCM. TITLE Direct Submission JOURNAL Submitted (08-JUL-2020) Molecular Biology and Biotechnology, University of Sheffield, Western Bank, Sheffield, South Yorkshire S10 2TN, United Kingdom REFERENCE 2 (bases 1 to 4680) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (08-JUL-2020) Molecular Biology and Biotechnology, University of Sheffield, Western Bank, Sheffield, South Yorkshire S10 2TN, United Kingdom" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..4680 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 28..744 /label=mTurquoise2 /note="enhanced monomeric variant of CFP (Goedhart et al., 2012)" CDS 754..780 /label=HA /note="HA (human influenza hemagglutinin) epitope tag" CDS 784..810 /label=HA /note="HA (human influenza hemagglutinin) epitope tag" CDS 814..840 /label=HA /note="HA (human influenza hemagglutinin) epitope tag" CDS join(1583..1750,1896..2108) /codon_start=1 /transl_table=11 /product="Ble" /label=Ble /note="zeocin resistance marker" /protein_id="QTE34489.1" /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD VTLFISAVQDQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPW GREFALRDPAGNCVHFVAEEQD" rep_origin 2417..2962 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS complement(3061..3873) /label=KanR /note="aminoglycoside phosphotransferase" CDS 4323..4625 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase"
This page is informational only.