Basic Vector Information
- Vector Name:
- pLM160-mNeonGreen
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5347 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Emrich-Mills TZ, Yates G, Barrett J, Grouneva I
pLM160-mNeonGreen vector Vector Map
pLM160-mNeonGreen vector Sequence
LOCUS 62056_14335 5347 bp DNA circular SYN 28-MAR-2021 DEFINITION Cloning vector pLM160-mNeonGreen, complete sequence. ACCESSION MT737961 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5347) AUTHORS Emrich-Mills TZ, Yates G, Barrett J, Grouneva I, Lau CS, Walker CE, Kwok TK, Davey JW, Johnson MP, Mackinder LCM. TITLE Direct Submission JOURNAL Submitted (08-JUL-2020) Molecular Biology and Biotechnology, University of Sheffield, Western Bank, Sheffield, South Yorkshire S10 2TN, United Kingdom REFERENCE 2 (bases 1 to 5347) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (08-JUL-2020) Molecular Biology and Biotechnology, University of Sheffield, Western Bank, Sheffield, South Yorkshire S10 2TN, United Kingdom" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5347 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 28..735 /label=mNeonGreen /note="bright monomeric yellow-green fluorescent protein derived from LanYFP (Shaner et al., 2013)" CDS 745..810 /label=3xFLAG /note="three tandem FLAG(R) epitope tags, followed by an enterokinase cleavage site" CDS 1908..2711 /codon_start=1 /transl_table=11 /product="APHVIII" /label=APHVIII /protein_id="QTE34481.1" /translation="MDDALRALRGRYPGCEWVVVEDGASGAGVYRLRGGGRELFVKVAA LGAGVGLLGEAERLVWLAEVGIPVPRVVEGGGDERVAWLVTEAVPGRPASARWPREQRL DVAVALAGLARSLHALDWERCPFDRSLAVTVPQAARAVAEGSVDLEDLDEERKGWSGER LLAELERTRPADEDLAVCHGDLCPDNVLLDPRTCEVTGLIDVGRVGRADRHSDLALVLR ELAHEEDPWFGPECSAAFLREYGRGWDGAVSEEKLAFYRLLDEFF" rep_origin 3084..3629 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS complement(3728..4540) /label=KanR /note="aminoglycoside phosphotransferase" CDS 4990..5292 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase"
This page is informational only.