Basic Vector Information
- Vector Name:
- pSA_HTK
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3894 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Groseclose TM, Hersey AN, Huang BD, Wilson CJ.
pSA_HTK vector Vector Map
pSA_HTK vector Sequence
LOCUS 62056_19240 3894 bp DNA circular SYN 16-AUG-2021 DEFINITION Cloning vector pSA_HTK, complete sequence. ACCESSION MZ198783 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3894) AUTHORS Groseclose TM, Hersey AN, Huang BD, Wilson CJ. TITLE Direct Submission JOURNAL REFERENCE 2 (bases 1 to 3894) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (13-MAY-2021) Chemical " COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..3894 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 596..673 /label=lacI promoter CDS 674..1720 /codon_start=1 /transl_table=11 /product="SA_HTK" /label=SA_HTK /protein_id="QYJ58360.1" /translation="MKPVTLYDVAEYAGVSHTTVSKVVNQASHVSAKTREKVEAAMAEL NYIPNRVAAQLAGKQSDTIGVVVMDVTDAFFGALVKAVDQVAQQHQKYVAIGNSYHEAE KERHAIEVLIRQRCNALIVHSKALSDDELAQFMDNIPGMVLINRVVPGYAHRCVCLDNL SGARMATRMLLNNGHQRIGYLSSSHGIEDDAMRKAGWMSALKEQDIIPPESWIGAGTPD MPGGEAALVKLLGRNLQLTAVFAYNDNMAAGALTALKDNGIAIPLHLSIIGFDDIPIAR YTDPQLTTVRYPIASMAKLATELALQGAAGNIDPRASHCFMPTLVRRHSVATRQNAAAI TNSTNQAM" protein_bind 1850..1871 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin 2062..2606 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." promoter 3132..3234 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 3235..3891 /label=CmR /note="chloramphenicol acetyltransferase"
This page is informational only.