Basic Vector Information
- Vector Name:
- pSEVA2514-rec2-mutLE36KPP
- Antibiotic Resistance:
- Kanamycin
- Length:
- 9354 bp
- Type:
- Cloning vector
- Replication origin:
- RSF1010 oriV
- Source/Author:
- Aparicio T, Nyerges A, Martinez-Garcia E, de Lorenzo V.
- Promoter:
- lac UV5
pSEVA2514-rec2-mutLE36KPP vector Vector Map
pSEVA2514-rec2-mutLE36KPP vector Sequence
LOCUS 62056_19505 9354 bp DNA circular SYN 28-MAR-2020 DEFINITION Cloning vector pSEVA2514-rec2-mutLE36KPP, complete sequence. ACCESSION MN180222 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9354) AUTHORS Aparicio T, Nyerges A, Martinez-Garcia E, de Lorenzo V. TITLE High-efficiency multi-site genomic editing (HEMSE) of Pseudomonas putida through thermoinducible ssDNA recombineering JOURNAL bioRxivorg (2019) REFERENCE 2 (bases 1 to 9354) AUTHORS Aparicio T, Martinez-Garcia E, de Lorenzo V. TITLE Direct Submission JOURNAL Submitted (15-JUL-2019) Systems Biology Program, Centro Nacional de Biotecnologia, CSIC, Darwin 3, Madrid, Madrid 28049, Spain REFERENCE 3 (bases 1 to 9354) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "bioRxivorg (2019)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-JUL-2019) Systems Biology Program, Centro Nacional de Biotecnologia, CSIC, Darwin 3, Madrid, Madrid 28049, Spain" FEATURES Location/Qualifiers source 1..9354 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(12..722) /label=lambda repressor (ts) /note="temperature-sensitive variant of the phage lambda repressor" regulatory complement(729..752) /label=tir region /note="tir region" /regulatory_class="other" regulatory complement(753..858) /label=PKan (Km promoter) /note="PKan (Km promoter)" /regulatory_class="promoter" primer_bind 1009..1032 /label=R24 /note="R24" regulatory 1033..1414 /label=PL promoter /note="PL promoter" /regulatory_class="promoter" gene 1455..2258 /gene="rec2" /label=rec2 CDS 1455..2258 /codon_start=1 /transl_table=11 /gene="rec2" /product="Rec2" /label=rec2 /note="Rec2 recombinase" /protein_id="QIP75692.1" /translation="MSNAALAERQNETQLLDAPAGAVQATESSMMIQMIQRAAADPAVD VDKMERLMQMHERFVDRQASAAFNAAMVRAQRRIKPVARRALNVQTNSTYARLEDIDRE ISPIFTEEGFSLSFGTGDSHLAGYIRVICDVMHDQGHTRQYKMDLPLDATGIGGKTNKT GVHAHGSTNSYARRYLTMNIFNVVMANEDTDGNAEPPEEPVITSRQAAQLEALLKKCSP TMAGLFIEKYGCASNVYKSEFDEVLAKLTRSANRTQQEPVDANHH" gene 2287..4185 /gene="mutLE36KPP" /label=mutLE36KPP CDS 2287..4185 /codon_start=1 /transl_table=11 /gene="mutLE36KPP" /product="MutLE36KPP" /label=mutLE36KPP /note="Dominant negative allele" /protein_id="QIP75693.1" /translation="MSGGSRIQLLSPRLANQIAAGEVVERPASVAKELLKNSLDSGARR IDIEVEQGGVKLLKVRDDGSGISADDLPLALARHATSKIRELEDLEGVLSLGFRGEALA SISSVARLTLTSRTASASEAWQVETEGRDMTPRVQPAAHPVGTSVEVRDLFFNTPARRK FLKAEKTEFDHLQEVIRRLALARFDVGFHLRHNGKSILSLHEAHDEIARARRVGAICGP GFMEQALPIDVERNGLRLWGWVGLPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRD VLFNGRHPTFVLFLELEPNGVDVNVHPTKHEVRFREGRSVHDFLYGTLHRALADVRPED QLAAPAAVPELVRPTGQQAGEFGPQGEMRLASPVLEQPRAPQQSFSNGGSGAGYQYQYT PRPSQPLPAAEAQAVYREFYKPLETGAAPATALPESQGDIPPLGYALAQLKGIYILAEN AVGLVLVDMHAAHERIMYERLKVAMASEGLSGQPLLVPETLALSQREADCAEEHAQWFQ RLGFELQRLGPETLAIRQIPALLKQAEANRLVQDVLADLMEYGTSDRIQAHLNELLGTM ACHGAVRANRRLAIPEMNALLRDMENTERSGQCNHGRPTWTQMGLDDLDKLFLRGR" primer_bind complement(4200..4223) /label=F24 /note="F24" terminator 4234..4328 /label=lambda t0 terminator /note="transcription terminator from phage lambda" CDS 4460..5272 /label=KanR /note="aminoglycoside phosphotransferase" oriT 5442..5550 /label=oriT /note="incP origin of transfer" CDS complement(5564..6412) /label=RSF1010 RepC /note="replication protein C of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS complement(6402..7238) /label=RSF1010 RepA /note="replication protein A of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS complement(7752..8720) /label=RSF1010 RepB /note="replication protein B of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" promoter complement(8744..8774) /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" rep_origin 8830..9224 /label=RSF1010 oriV /note="replication origin of the broad-host-range plasmid RSF1010; requires the RSF1010 RepA/B/C proteins for replication (Scholz et al., 1989)" terminator complement(9262..9348) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.