Basic Vector Information
- Vector Name:
- pEEva2
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3700 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Shneider MM.
pEEva2 vector Map
pEEva2 vector Sequence
LOCUS 62056_8815 3700 bp DNA circular SYN 11-AUG-2019 DEFINITION Cloning vector pEEva2, complete sequence. ACCESSION MK533800 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3700) AUTHORS Shneider MM. TITLE Direct Submission JOURNAL Submitted (18-FEB-2019) Laboratory of Molecular Bioengineering, IBCH, Miklukho-Maklaya str. 16/10, Moscow, Moscow 117997, Russian Federation REFERENCE 2 (bases 1 to 3700) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (18-FEB-2019) Laboratory of Molecular Bioengineering, IBCH, Miklukho-Maklaya str. 16/10, Moscow, Moscow 117997, Russian Federation" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..3700 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 12..467 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 494..598 /label=AmpR promoter CDS 599..1456 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 1630..2218 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(2404..2546) /label=bom /note="basis of mobility region from pBR322" CDS complement(2651..2839) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" promoter 3348..3366 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 3367..3391 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 3406..3428 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 3447..3464 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 3474..3494 /codon_start=1 /label=TEV site /note="tobacco etch virus (TEV) protease recognition and cleavage site" /translation="ENLYFQG" CDS 3544..3561 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 3628..3675 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase"
This page is informational only.